Details for Chinese cabbage Locus Brara.E02314

Position : A05 ( 5`- 21012228 .. 21013119 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02314

Protein [Map View]
MADYEDEIDQQNQPFIPKETALQALNTIIQLHFEKTLEKKRAIDHQKKKLHKLFQLFFIFLALIFFSLSQPSGRLHCRHC
WAPIVLLSFSHLFFYVSVAQTLRCINGFKYQRRCHKLTLGLATHKLRFIKSRIAAGDFCLGGGGGGGEDEVSASAAAWDL
EVPYQEPPDSYFGKFKRNWALYFGFLILLYTFMISFSVVILCF*

DNA
ATGGCGGACTACGAGGACGAGATTGACCAGCAGAACCAACCATTCATCCCCAAAGAAACAGCTCTCCAAGCCTTAAACAC
AATAATCCAGCTCCACTTCGAGAAAACTCTAGAGAAAAAGAGAGCCATTGACCACCAGAAGAAGAAGCTCCACAAGCTAT
TCCAGCTCTTCTTCATCTTCCTCGCCCTCATCTTCTTCTCCCTCTCACAGCCCTCAGGCCGTCTCCACTGCCGCCACTGC
TGGGCGCCAATCGTCCTCCTCTCCTTCTCCCATCTCTTCTTCTACGTCTCCGTAGCTCAAACCCTCCGCTGCATCAACGG
CTTCAAGTACCAGCGCCGCTGCCACAAGCTCACTCTCGGCCTCGCTACGCACAAGCTCCGTTTCATCAAGTCGCGCATAG
CCGCGGGAGATTTCTGCCTCGGTGGTGGTGGTGGCGGCGGAGAAGACGAGGTCTCAGCCTCCGCTGCTGCTTGGGATCTG
GAAGTTCCGTATCAGGAGCCACCGGATAGCTACTTTGGCAAGTTTAAGAGAAACTGGGCTCTCTACTTTGGGTTCTTGAT
CCTTCTTTACACTTTCATGATCTCCTTCTCTGTAGTCATCCTCTGTTTCTAG