Details for Chinese cabbage Locus Brara.E02309

Position : A05 ( 5`- 20969374 .. 20971678 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02309

Protein [Map View]
MEKKLTNSNNMSLIRMLRGIICLMVLVSTAFMMLIFWGFISAVVMRLFSLHYSRKCVSFFFGSWLALWPFLFEKINRTKV
IFSGDKVPCESRVLLIANHRTEVDWMYFWDLALRKGQIGNMKYVLKSSLMKLPLFGWAFHLFEFIPVERKWKVDEANLRQ
MVSSFKDPRDGLWLGLFPEGTDYTEAKCERSKKFAAENGLPELNNVLLPKTKGFVSCLEELDSSLDAVYDVTIGYKTRCP
SFLDNVYGTEPSEVHIHIRRISQNQIPNQEKEINAWLMNTFQLKDQLLSEFYSRGHFPNEGTEKEFSTIKQLINCLAVIV
FTIICTHLTFFSSMIWFKIYVSLVCAYLTYATHFNLRPAPLVETAKKSFQISKK*

DNA
ATGGAAAAGAAACTTACAAACTCTAATAACATGTCTCTGATAAGAATGTTAAGAGGTATCATATGTCTGATGGTGTTGGT
TTCAACAGCTTTTATGATGTTGATTTTCTGGGGGTTCATATCAGCTGTAGTGATGAGGCTTTTCAGCTTACACTACAGCC
GTAAATGTGTTTCTTTCTTCTTTGGCTCCTGGCTCGCCTTGTGGCCTTTCCTCTTTGAGAAGATCAACAGAACCAAAGTT
ATCTTCTCTGGGGACAAGGTTCCTTGTGAGTCACGAGTGTTGCTCATTGCCAATCACCGAACAGAGGTTGACTGGATGTA
CTTCTGGGATCTTGCACTGCGTAAAGGTCAGATTGGGAATATGAAGTATGTCCTTAAGAGCAGTCTGATGAAGTTGCCTC
TGTTCGGTTGGGCGTTTCACCTCTTTGAGTTTATCCCCGTTGAGCGGAAATGGAAAGTAGATGAAGCAAACTTGAGGCAG
ATGGTTTCCAGTTTCAAGGATCCTCGAGATGGTTTATGGCTTGGTCTTTTCCCCGAGGGCACAGATTACACAGAGGCTAA
ATGCGAAAGGAGCAAGAAGTTTGCAGCTGAGAATGGCCTTCCAGAACTGAACAATGTGTTGCTTCCCAAGACAAAAGGTT
TTGTCTCCTGCTTGGAAGAATTGGATTCCTCACTTGATGCAGTTTATGATGTGACCATCGGTTACAAAACCCGTTGTCCG
TCTTTCTTAGACAATGTCTATGGTACTGAACCATCAGAAGTTCACATCCACATCCGTCGTATCAGCCAAAACCAAATCCC
GAATCAGGAAAAGGAAATCAATGCTTGGTTAATGAACACATTCCAGCTCAAAGACCAGCTGCTCAGTGAGTTCTACTCTC
GTGGCCATTTCCCTAACGAAGGAACAGAAAAAGAGTTCAGCACAATAAAGCAACTCATAAACTGCTTGGCGGTGATTGTG
TTCACCATCATCTGCACGCATCTCACCTTCTTCTCGTCGATGATCTGGTTCAAGATATATGTCTCTTTGGTCTGTGCCTA
CTTGACCTATGCTACTCATTTCAATCTTCGTCCTGCGCCACTTGTTGAGACTGCAAAGAAAAGCTTTCAAATTAGTAAAA
AATGA