Details for Chinese cabbage Locus Brara.E02304

Position : A05 ( 5`- 20935900 .. 20939503 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02304

Protein [Map View]
MEGTSFLRGQPLTTVPSLPRKRFLLQGWKSNQIVRFSGLKNQSDSRKSRSFFDLSLRASDKGPIKASSAVTDASPTNSES
KEQDLVFVAGATGKVGSRTVRELLKLGFRVRAGVRSAQRAKGLVQSVKDMNTDEGTQPVEKLEVVECDLEKKDSIQPALG
NASVVICCIGASEKEISDITGPYRIDYLATKNLVDAATSAKVNNFILVTSLGTNKFGFPAAILNLFWGVLCWKRKAEEAL
IASGLNYAIVRPGGMERPTDAYKETHNLTLALDDTLFGGQVSNLQVAELLACMAKNPQLSCSKIVEVVAETTAPLTPIEK
LLKKIPSKRPYVPPPKESVPAKEVTPVPAEPVKQESVAAKEVTPVLTEPVTKEPTAPKEDKAPAEVKDVKPRPLSPYAAY
EDLKPPTSPIPATALGATKAKEVDATPVPEVEETQAPVEANAVPPPESPVETSVPVVEEVKQVEEKKERPLSPYASYENL
KPPSSPTPKASGIQKSDTLAPVPTDSDTGESSTVATTVTEEAEAPPAIPKMRPLSPYAAYADLKPPTSPTPASTGPKKTA
PAEEISELPGGNDVLQTVDGSVITTESASVPETETVNSVTDTSLTPEESAADQPKPRPLSPYTMYEDMKPPTSPLPSPVI
NH*

DNA
ATGGAAGGAACTAGTTTTCTCCGAGGGCAGCCTCTAACAACAGTACCCTCTCTTCCCAGAAAAAGGTTCCTCCTCCAAGG
ATGGAAGAGCAATCAGATTGTCAGGTTTTCAGGTTTGAAGAATCAATCCGATTCTCGAAAGTCAAGGTCTTTCTTCGATC
TTAGCCTCAGAGCTTCAGACAAAGGTCCCATAAAGGCAAGCTCTGCCGTAACTGATGCAAGCCCCACGAACTCAGAATCC
AAGGAACAAGACCTTGTCTTTGTAGCTGGTGCTACCGGTAAAGTTGGTTCTAGGACTGTAAGGGAGCTACTGAAGCTCGG
ATTCCGAGTAAGAGCTGGAGTTCGAAGCGCTCAGAGAGCAAAAGGTCTTGTGCAGAGTGTTAAGGATATGAACACAGATG
AAGGAACTCAACCTGTAGAAAAGCTTGAAGTTGTGGAATGTGACTTGGAGAAGAAAGACTCAATACAGCCTGCTTTGGGG
AATGCATCTGTGGTTATATGCTGCATTGGTGCTAGCGAGAAAGAAATATCCGATATCACCGGCCCTTACAGGATTGATTA
CTTAGCCACCAAAAACCTTGTTGATGCTGCAACATCTGCAAAAGTTAATAACTTCATCTTGGTGACATCCTTGGGGACCA
ATAAATTTGGATTCCCTGCTGCCATTCTCAATTTATTCTGGGGAGTTCTTTGCTGGAAGAGAAAAGCTGAAGAAGCCTTG
ATTGCAAGCGGCCTCAATTACGCAATAGTTAGGCCTGGAGGAATGGAGAGACCAACTGATGCATACAAGGAGACTCATAA
TCTGACTCTTGCTCTAGATGATACATTGTTTGGTGGTCAGGTCTCTAATCTCCAGGTTGCAGAATTGCTAGCTTGTATGG
CTAAGAACCCTCAACTTTCTTGCTCTAAGATTGTGGAAGTGGTTGCTGAAACAACTGCACCATTAACCCCTATTGAAAAG
CTTCTTAAAAAGATTCCTTCCAAACGTCCTTATGTGCCTCCACCAAAGGAATCAGTTCCAGCCAAAGAGGTAACACCAGT
TCCTGCTGAGCCTGTCAAGCAAGAATCAGTTGCAGCCAAAGAGGTAACACCAGTCCTTACTGAGCCTGTCACTAAAGAAC
CAACAGCTCCCAAGGAGGATAAAGCACCTGCAGAAGTGAAAGATGTTAAGCCTAGGCCGCTGTCTCCTTATGCCGCCTAT
GAAGACTTGAAACCTCCAACATCTCCTATTCCGGCCACAGCACTTGGTGCCACCAAAGCTAAGGAGGTGGATGCAACTCC
GGTTCCGGAGGTGGAAGAAACTCAGGCTCCTGTTGAGGCTAATGCAGTTCCACCACCAGAAAGTCCTGTTGAGACCAGTG
TCCCAGTAGTAGAAGAAGTGAAGCAAGTTGAGGAAAAGAAAGAGAGGCCTCTTTCTCCTTATGCTAGCTATGAGAATCTA
AAACCACCTTCATCTCCCACTCCTAAAGCTTCTGGTATCCAGAAGAGCGATACTTTGGCGCCTGTTCCAACAGATTCTGA
CACTGGTGAAAGCTCAACAGTTGCAACAACTGTCACTGAGGAGGCAGAAGCACCCCCAGCCATACCAAAAATGAGACCTC
TTTCTCCTTATGCAGCTTACGCAGACCTGAAACCACCAACCTCACCCACTCCTGCATCAACCGGTCCCAAGAAAACAGCA
CCTGCAGAAGAAATCTCAGAGTTGCCTGGAGGGAATGATGTGCTGCAAACGGTTGATGGTAGTGTGATCACGACTGAATC
TGCTTCTGTGCCAGAGACAGAAACTGTTAACAGTGTGACAGACACTTCCCTTACACCAGAAGAAAGTGCAGCTGATCAGC
CAAAACCAAGGCCATTGTCACCTTACACAATGTATGAGGACATGAAGCCTCCAACATCACCTCTTCCATCTCCGGTCATC
AATCATTAG