Details for Chinese cabbage Locus Brara.E02293

Position : A05 ( 5`- 20887250 .. 20887716 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02293

Protein [Map View]
MVSQKLEICIELVKIGVVFVATVAESVEKAFRKPPPSLPAVHDSRRNSYADVPIPLVGFM*

DNA
ATGGTGTCTCAAAAGCTAGAGATCTGCATCGAATTAGTGAAGATTGGCGTCGTTTTTGTCGCCACTGTGGCTGAATCAGT
AGAAAAAGCTTTCCGTAAGCCACCACCGTCGCTTCCGGCAGTTCATGATAGTCGCCGGAACAGTTACGCCGACGTTCCTA
TTCCTCTTGTTGGATTCATGTGA