Details for Chinese cabbage Locus Brara.E02290

Position : A05 ( 5`- 20843924 .. 20846359 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02290

Protein [Map View]
MAQMHREDVESVTADKKVSDGGGGGGGGSSGAQASSFKFNAEAPEFVPQSRAAVATPQVSPISGYFYPCFHYSDGGGTAV
GTQASDWFFVGGGDPAQHPHVHDPAAAYYVPSPAVQFPVNQNSSPSSSLLSDDLRLKIVKQVEYQFTDMSLLANESISKH
MNKDPEGYVPISYIASTKKIKALTSNHHLVSLALRSSSKLVVSEDNKKVKRKVPFTDRDREDLQGRTVVAENLPDDHSYQ
NLEKIFGVVGNVKAIRICHPPESNSSRPKGDFLMSNKIHALIEYDHTVVADKAVEKLNDERNWRKGLRVRLLLRCSPKSV
LKHRRNFDGILIDDESPYESGEDSPRLHLTEHQLDNEGDENTLGGLWGKGRGKGRGRSPRSYVVGGGERSFGIGMGLSLG
PMSPSLGLHGSSSPKTATKGPRMPDGTRGFTMGRGKPVNLSLI*

DNA
ATGGCGCAGATGCACCGAGAAGATGTTGAATCCGTCACGGCGGATAAGAAAGTATCAGACGGAGGAGGAGGCGGCGGCGG
CGGATCTTCCGGCGCTCAGGCGTCATCGTTCAAATTCAACGCCGAGGCACCGGAGTTCGTACCGCAATCGCGTGCCGCCG
TGGCAACACCGCAGGTTTCTCCGATCTCCGGTTACTTTTATCCTTGCTTTCACTACAGCGACGGAGGAGGGACGGCGGTC
GGTACTCAGGCGTCGGATTGGTTCTTCGTCGGAGGAGGAGATCCTGCTCAGCATCCACACGTTCACGATCCGGCGGCTGC
GTATTACGTTCCGAGTCCGGCGGTTCAGTTTCCGGTGAATCAGAACTCTTCTCCTTCTTCTTCGTTGCTCTCTGATGATC
TCCGCCTTAAGATCGTCAAACAGGTTGAGTACCAGTTCACGGATATGAGTCTCTTAGCTAATGAGTCCATCTCAAAGCAC
ATGAACAAAGACCCTGAAGGTTATGTGCCAATATCTTACATTGCTTCGACCAAGAAGATCAAGGCTTTAACGAGTAACCA
CCACTTAGTTTCATTGGCTCTACGCTCCTCCTCTAAGCTTGTTGTGAGTGAAGACAACAAGAAAGTTAAGCGTAAAGTTC
CATTTACTGATAGAGACAGAGAGGATTTGCAGGGCCGGACCGTTGTTGCAGAGAATCTACCAGATGATCACTCCTACCAG
AACCTTGAGAAGATCTTTGGAGTTGTTGGAAACGTTAAAGCGATTAGAATCTGTCATCCTCCAGAATCAAACTCCTCTCG
TCCAAAAGGAGATTTCTTGATGAGCAACAAAATTCACGCACTGATCGAGTATGACCACACTGTTGTCGCGGATAAAGCTG
TGGAGAAGCTGAACGATGAAAGAAACTGGAGGAAAGGACTTCGTGTGAGGCTGCTTCTTAGATGCTCGCCCAAATCAGTG
CTCAAGCACAGAAGAAACTTTGATGGCATCCTCATAGATGATGAAAGTCCTTATGAATCTGGAGAAGACTCTCCACGTCT
CCATTTAACCGAGCATCAGCTTGATAACGAGGGTGATGAGAACACTCTTGGAGGACTGTGGGGAAAAGGGAGAGGAAAAG
GAAGAGGACGGTCTCCAAGAAGCTATGTGGTAGGAGGAGGAGAACGTAGCTTCGGGATCGGGATGGGACTCAGCCTCGGC
CCAATGTCACCGAGCCTAGGTTTACACGGATCTTCGTCTCCAAAAACAGCAACAAAGGGACCAAGGATGCCTGATGGTAC
AAGAGGGTTCACCATGGGACGTGGCAAACCCGTCAATCTCAGTCTTATCTAA