Details for Chinese cabbage Locus Brara.E02286

Position : A05 ( 5`- 20814312 .. 20819036 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02286

Protein [Map View]
MPVLYTFPVLPSSLLRGISNRGTSIILHPPEVQISCFLVARSDPGEFDGFSFSSRRRRLNAGGGGAHVVDNAPSRTSSLA
ASTSTIEIPVTCYQLIGVSEKAEKDEVVKSVLNLKKADAEEGYTMEAAAARQDLLMDVRDKLLFEPEYAGNLKENITPKS
PLRIPWAWLPAALCLLQEVGEEKLVLDIGRSVLRHLDSKPYIHDIFLAMALSECAVAKDAFEANKVSQGFEALARAQSFL
KSKVTLGKLALLSQIEESLEELAAPCTLDLLGLPPLPENAERRRGAVAALRELLRQGLDVEASCQIQDWPCFLTQAISRL
LATEIVDLLPWDTLAITRKNKKSLESHNQRVVIDFNCFYLVLVAHIAVGFSVKQTDKINKAKSICECLIASEGVDLKFEE
AFCSFLLNQGSEAEALEKLKQLDSNSDSAVRNSILGKELRTTSATPSLEAWLKDSVLANFPDTRGCSPSLANFFRAEKKY
PVNKKMGSPPIINHKTNQRPISSMQFMNSSQHIYTAVEQLAPTNLQSPVASTKNIDESGASRPSVQLKRNLGLQQNKIWN
GWLSQSSLIQRVSVAALLGCTVFFSLKLTGIRSGRLQSLPTWGSAKPHLESDSGNFRRNLASVNRKGVVGNIKTLLDMLK
RHHGEHSDALYLKSSGLSATLSHPTSEVHKRPMLTEDAEELVRQWENIKAEALGPTHQVYSLPEVLDEAMLIQWQTLAQT
AKAKSCYWRFVLLNLEILQAHISTDGSIAGETAEIEAFLEEAAELVDESQPKNAKYYSTYKIRYTLKKQEDGSWRFCQSD
IQIQK*

DNA
ATGCCAGTGCTCTACACGTTTCCAGTTCTCCCTTCTTCTCTGCTCCGCGGAATTTCTAATCGCGGCACCAGCATCATCCT
ACATCCTCCCGAGGTTCAGATCTCATGTTTTCTCGTCGCGCGTTCTGATCCCGGAGAATTCGACGGTTTTAGTTTCTCTT
CGCGGCGGAGGAGATTGAATGCTGGTGGTGGTGGTGCACATGTCGTCGATAATGCTCCGTCTCGTACCTCTTCGCTCGCT
GCATCTACATCCACAATCGAAATCCCGGTTACTTGTTACCAGCTTATCGGAGTTTCTGAAAAAGCTGAGAAGGACGAGGT
CGTTAAGTCGGTGTTGAATTTGAAGAAAGCTGATGCTGAAGAAGGATATACAATGGAAGCTGCTGCAGCTCGCCAGGATC
TTCTCATGGATGTTAGGGATAAACTTCTTTTTGAACCAGAGTATGCTGGTAACCTTAAAGAAAATATTACTCCTAAATCT
CCTCTTAGAATCCCATGGGCTTGGTTGCCTGCTGCTCTCTGCCTTCTTCAAGAGGTTGGAGAAGAAAAACTTGTGCTGGA
TATTGGCCGGTCTGTTCTCAGGCACCTTGATTCAAAGCCATATATTCATGATATATTTTTGGCTATGGCACTTTCTGAGT
GCGCGGTCGCCAAGGATGCCTTCGAGGCGAACAAAGTCTCTCAAGGATTTGAAGCTCTTGCTCGTGCTCAGTCTTTTCTG
AAGAGTAAAGTTACTCTTGGGAAACTTGCATTGTTATCTCAGATAGAAGAGTCCTTGGAGGAGCTTGCAGCACCATGCAC
ATTAGATCTACTGGGCCTACCTCCCTTGCCGGAAAATGCGGAGAGGAGACGAGGTGCAGTTGCAGCGCTACGTGAACTTC
TGAGACAAGGCCTTGATGTTGAAGCTTCCTGTCAAATTCAAGACTGGCCATGCTTTTTGACCCAGGCAATTAGCAGGCTA
CTGGCCACAGAGATTGTTGATCTCCTTCCATGGGATACCTTGGCCATTACACGGAAAAATAAAAAATCACTTGAATCACA
TAATCAAAGAGTAGTAATTGATTTTAATTGTTTCTACTTGGTGTTGGTTGCTCATATCGCTGTTGGATTTTCAGTCAAGC
AAACTGATAAGATTAATAAAGCAAAATCTATATGCGAATGTCTAATAGCATCAGAAGGTGTTGATCTGAAATTTGAGGAA
GCTTTTTGCTCATTTCTTCTAAACCAGGGTTCCGAGGCTGAAGCCCTTGAAAAACTTAAGCAGCTGGATTCAAATTCAGA
CTCTGCGGTTCGTAATTCGATCTTGGGGAAAGAGTTGAGAACTACTTCTGCAACACCATCGTTGGAAGCGTGGCTAAAGG
ATTCAGTGCTTGCCAACTTTCCAGACACAAGGGGTTGTTCGCCATCTTTGGCCAACTTTTTCCGGGCTGAAAAAAAATAT
CCAGTGAACAAGAAAATGGGGTCACCGCCAATTATTAATCACAAGACGAACCAAAGACCGATTTCCTCTATGCAGTTCAT
GAACTCATCACAACATATTTATACAGCTGTCGAGCAATTGGCACCAACAAATCTGCAGAGCCCAGTAGCATCAACAAAGA
ATATTGATGAAAGCGGTGCCAGTAGGCCATCGGTTCAACTGAAAAGGAACCTTGGTTTACAGCAAAATAAAATATGGAAT
GGTTGGCTCTCTCAGAGCAGTTTGATCCAAAGGGTATCTGTTGCTGCTTTATTAGGTTGTACCGTGTTCTTCTCTCTAAA
GCTAACAGGCATTAGGTCTGGTAGATTACAGAGCCTGCCTACATGGGGTTCTGCAAAGCCGCACTTGGAATCAGATTCTG
GGAATTTCAGAAGAAACCTTGCTTCTGTGAACAGAAAGGGTGTCGTGGGCAACATCAAAACACTCTTGGACATGTTGAAG
AGGCATCATGGGGAACATTCGGATGCCTTGTATCTAAAAAGCTCTGGTCTATCGGCTACGTTGTCTCATCCCACCTCGGA
AGTTCACAAAAGACCAATGCTTACAGAAGACGCCGAAGAGCTTGTGAGACAGTGGGAAAATATTAAAGCTGAAGCTCTTG
GACCTACACATCAAGTTTATAGCCTTCCTGAAGTCCTTGACGAAGCCATGCTTATCCAGTGGCAAACGTTGGCGCAAACA
GCAAAAGCTAAATCTTGTTATTGGAGATTCGTTTTGCTTAATCTTGAGATTTTGCAAGCGCACATATCCACAGATGGTAG
TATTGCTGGTGAGACTGCCGAGATTGAGGCCTTTCTAGAGGAAGCAGCAGAACTAGTTGACGAGTCTCAGCCCAAAAACG
CAAAATATTACAGCACTTACAAGATCCGCTATACTCTGAAGAAGCAAGAAGATGGATCGTGGAGATTCTGCCAAAGCGAT
ATCCAAATACAGAAATGA