Details for Chinese cabbage Locus Brara.E02282

Position : A05 ( 5`- 20789861 .. 20791659 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02282

Protein [Map View]
MFRLYPNCSLPSLLFLPRLPPSRSFRCRATADIPLGDGIRIPREQDSSSDTARSRDVSAAAGGNGESGKWRKRRLLWSKS
GVSYLVGDDDALPLPMTYPNTSPVSPDEIDRRLQCDPVVEDCKEVVYEWTGKCRSCQGSGSVSYYKKRGKEVICKCIPCQ
GIGYVQKITSRTDIDVMEDLDNEAS*

DNA
ATGTTCCGATTATACCCAAACTGCTCTCTACCTTCTCTCCTCTTCCTTCCCCGCCTTCCTCCTTCTCGCTCCTTCCGTTG
CCGCGCCACCGCCGATATCCCCCTAGGCGACGGAATCCGGATACCGCGTGAACAGGATTCCTCCTCTGACACGGCGAGGT
CTCGAGATGTCTCCGCCGCGGCCGGAGGGAACGGTGAATCGGGTAAGTGGAGGAAAAGGAGGCTGCTGTGGTCGAAAAGC
GGAGTGAGTTACTTGGTAGGAGACGACGACGCGCTTCCTCTGCCTATGACTTATCCGAATACATCCCCTGTGTCGCCCGA
TGAGATTGACCGGAGGTTGCAGTGCGATCCTGTTGTCGAGGATTGCAAGGAAGTGGTTTATGAGTGGACTGGCAAGTGTA
GAAGTTGCCAAGGATCTGGATCTGTCAGCTATTACAAGAAAAGGGGTAAAGAGGTTATCTGCAAATGCATACCTTGCCAA
GGGATAGGATATGTGCAGAAGATAACATCTCGAACGGACATTGATGTGATGGAAGATTTGGATAATGAAGCATCTTGA