Details for Chinese cabbage Locus Brara.E02274

Position : A05 ( 5`- 20746657 .. 20748964 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02274

Protein [Map View]
MESLYSSGGVRNLEASTAAWNFQIAVYFAFGFFFLRLFLDRFVFERIAVWLLSTASSAPIKMNDASTRAKIVKCKESLWK
LLFYGACDIFVLKVLFREPWATDVKLYFHGWPNQELKLPIKLYYMCQCGFYMYAVAALLAWETRRKDFSVMMSHHVVTII
LLVYSYLTGFFRIGAIIIALHDASDVFMETAKICKYSEKEFGASVGFSLFALSWLLLRLIYFPFWIIRATSIELLDHVDM
TSAEGTIMYYSFNTLLLTLLVFHIYWWYLICAMIARLLKNRGQVGEDIRSDSEDDE*

DNA
ATGGAATCGTTATATTCTAGCGGCGGGGTAAGGAATCTTGAAGCGTCGACTGCGGCGTGGAATTTCCAGATAGCAGTCTA
TTTCGCCTTCGGATTCTTCTTCTTGAGACTTTTCCTCGATAGATTCGTCTTTGAAAGGATAGCTGTATGGCTTTTGAGCA
CCGCTTCTTCTGCGCCTATTAAAATGAACGATGCTTCTACTCGGGCTAAGATCGTCAAGTGCAAAGAGTCTCTGTGGAAG
CTCTTGTTTTACGGTGCTTGTGACATATTCGTTCTCAAAGTCCTTTTTCGCGAGCCATGGGCCACTGATGTCAAACTCTA
CTTTCACGGTTGGCCTAACCAAGAGTTGAAGCTTCCGATAAAGCTTTACTATATGTGCCAGTGCGGTTTCTATATGTATG
CTGTTGCTGCCTTGCTTGCATGGGAGACAAGACGAAAAGATTTTTCTGTTATGATGTCTCACCATGTCGTTACCATCATC
CTCCTTGTCTACTCCTACTTAACGGGCTTTTTCAGAATAGGAGCAATCATCATAGCCCTTCATGATGCAAGCGACGTGTT
TATGGAAACTGCTAAAATTTGCAAGTACTCTGAAAAGGAATTTGGAGCGAGTGTGGGTTTTTCACTCTTTGCTCTCTCTT
GGCTACTGCTTAGGTTGATTTACTTTCCATTTTGGATCATCAGGGCCACTAGCATTGAACTCCTGGATCATGTGGATATG
ACATCAGCTGAAGGCACCATCATGTACTATTCCTTCAACACACTGTTACTGACGCTTCTTGTTTTCCACATATATTGGTG
GTATCTCATCTGCGCAATGATTGCAAGACTACTTAAAAACAGAGGACAAGTGGGAGAAGACATAAGATCCGATTCAGAGG
ATGATGAATAG