Details for Chinese cabbage Locus Brara.E02271

Position : A05 ( 5`- 20709129 .. 20712630 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02271

Protein [Map View]
MGTHINFNNLGGGGGGGGDPGGEGFNQMKATDTAYPLARQSSLYSRTFDELQSLLGGPGKDYGSMNMDELLKSIWTAEEA
QAMSMTMTSSAATTMVQPGGNLQRQGSLTLPRTISQKTVDEVWKCLITKDGGGSSGGGGGESNNAPQRQQTLGEMTLEDF
LFRAGVVREDNNSSQQMGQVTGNNNNGFYGNNGAPGGLGFEFGQTNQNTISFNNGTMQQQQFQQQPQQQSRQQLNQSLPQ
QQRVPQTIFPKQANVAFTGPVGMVNKSFNGAVNNSLNNTNGLASFGGTGVTVAATSPGTSSAENNSLSPVPYVLNRGRRS
NTGLEKVIERRQRRMIKNRESAARSRARKQAYTLELEAEIEKLKKVNQELQRKQAEMMEMQKNEQLKESSKKPWGSKRQC
LRRTLTGPW*

DNA
ATGGGAACTCACATCAATTTCAACAACTTAGGAGGTGGTGGTGGTGGTGGTGGTGACCCTGGTGGGGAAGGATTCAACCA
GATGAAGGCAACAGATACTGCATATCCCTTGGCGAGACAGTCTTCGCTTTACTCACGAACGTTTGATGAGCTTCAGAGCT
TACTAGGTGGACCTGGAAAAGATTACGGGTCGATGAACATGGATGAACTCTTGAAGAGCATATGGACTGCTGAGGAAGCT
CAGGCCATGTCCATGACCATGACTTCTTCAGCTGCTACAACGATGGTGCAACCTGGTGGGAATCTCCAGAGGCAAGGCTC
GTTGACGTTGCCTAGAACGATTAGTCAGAAGACTGTTGATGAGGTCTGGAAATGTCTGATCACCAAAGACGGTGGAGGTA
GCAGCGGAGGTGGCGGTGGTGAGTCTAATAATGCTCCTCAGAGGCAGCAGACTTTAGGGGAAATGACACTTGAGGACTTT
CTGTTCCGGGCTGGAGTTGTAAGAGAAGATAACAACTCTTCACAGCAGATGGGTCAGGTCACCGGAAACAATAACAACGG
CTTTTATGGTAACAACGGAGCTCCTGGGGGATTAGGCTTTGAGTTTGGTCAGACAAATCAAAACACCATATCATTCAACA
ATGGTACAATGCAGCAGCAGCAGTTTCAACAACAGCCACAACAGCAGTCACGGCAGCAGCTGAATCAGTCACTTCCGCAG
CAGCAGCGGGTGCCTCAGACCATTTTTCCTAAACAAGCAAATGTAGCATTTACTGGGCCGGTGGGTATGGTCAACAAGAG
TTTTAATGGGGCTGTGAATAATTCACTGAACAATACTAATGGTTTAGCTAGTTTCGGAGGAACCGGGGTCACTGTTGCAG
CAACGTCTCCAGGGACAAGCAGCGCAGAAAACAACTCTCTGTCGCCAGTTCCTTATGTGCTTAATCGAGGAAGAAGAAGC
AATACTGGTCTAGAGAAGGTTATCGAGAGGAGGCAAAGGAGAATGATCAAGAACCGAGAATCAGCTGCTAGATCAAGAGC
TCGAAAGCAGGCTTACACCTTGGAACTGGAAGCTGAAATTGAAAAGCTCAAGAAAGTTAATCAAGAATTGCAGAGAAAAC
AGGCTGAAATGATGGAAATGCAGAAGAATGAGCAGCTGAAGGAATCGTCGAAGAAACCATGGGGCAGCAAAAGACAATGC
TTGAGAAGGACATTAACCGGTCCATGGTGA