Details for Chinese cabbage Locus Brara.E02270

Position : A05 ( 5`- 20706674 .. 20709726 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02270

Protein [Map View]
MVLHKQALLLTFISVLGIHQLPSPTEAECPLDLTSSNFTLVASVCSTNADRAKCCRYMNAFVAVSVSRYANHTADLGVAP
DLTSICITTISRTMELYGIPTNATLFCGLGTKILVSYDCEGLTTVTQMLQSPKFGDVSRNCELPFRCKSCLNSGITYIRS
LVDRGNNIKMSTCRDATYAALASRVDSSSALELASCFFNVSELSTTPEFPLSPEASPSPVVADSPSGNDDLVLSPRRSHH
GYHLTVVPAIGIAVTVFSVMMLAVLIVLIQRKKRELDDDDDCKSKDHNPTKTLPSSLPKVMMIHEGSSLAFRKFSYREIR
KATKEFSSVIGSGGFGTVHRGEFSNGLVAAVKRMKRSSEQADDEFCREIELLARLHHRHLVALKGFCTKKNESFLVYEYM
ANGSLTDHLHSTEKPPLSWATRMKIAIDVANALEYLHLYCDPPLCHRDIKSSNILLDDNFVAKLADFGLAHASRDGSVCF
EPINTDIRGTPGYVDPEYVVTQELTEKSDVYSYGVVLLEIITGRRAVDEGRNLVEMSQPLLVSESRRVDLVDPRIKDCID
GEQLETVVAVVRWCTEKEGVARPSIKQVLRLLCESCDPLHMELAMAVEEHKGRSLRGGGDSGLASSSSTTSRSHCSRSFL
LETGSPPNGLSF*

DNA
ATGGTGCTTCACAAGCAAGCTCTCTTGCTCACATTCATCTCAGTTCTTGGAATCCATCAACTGCCTTCACCAACAGAAGC
AGAATGTCCACTGGACTTGACCTCATCAAACTTCACTCTCGTCGCCTCCGTCTGCTCCACCAACGCCGACAGAGCCAAAT
GCTGCCGCTACATGAACGCCTTCGTCGCCGTATCCGTCTCCCGCTACGCTAACCACACGGCGGATCTCGGAGTGGCACCA
GACTTGACCTCCATCTGCATCACCACCATCTCAAGAACCATGGAGCTCTACGGCATCCCAACTAACGCGACGCTCTTCTG
CGGACTAGGGACCAAGATCCTCGTCAGCTACGACTGCGAAGGTCTCACCACTGTTACTCAAATGCTTCAGTCCCCAAAGT
TTGGAGATGTTTCAAGAAACTGCGAGCTGCCGTTTCGTTGCAAGAGCTGCTTGAACTCTGGTATCACTTACATTCGTAGT
TTGGTGGATAGAGGGAATAACATTAAGATGAGTACTTGTAGGGATGCGACCTACGCTGCTTTAGCTAGCCGTGTTGATAG
TAGTTCAGCTCTTGAGCTTGCTAGCTGCTTCTTTAATGTGTCTGAGCTTAGCACCACTCCAGAGTTTCCGTTGAGTCCAG
AAGCTTCTCCAAGTCCAGTGGTAGCTGATAGTCCAAGTGGCAATGATGATCTTGTTCTGTCTCCAAGAAGAAGTCACCAT
GGTTATCACTTGACGGTGGTTCCGGCTATTGGGATCGCTGTTACAGTGTTTTCTGTTATGATGCTAGCTGTGTTAATAGT
TCTTATCCAAAGAAAGAAACGGGAGCTTGATGATGATGATGACTGCAAGAGCAAGGATCATAATCCAACGAAGACGCTTC
CTTCTTCCCTCCCTAAAGTGATGATGATTCATGAAGGTAGTTCGTTGGCTTTTAGGAAATTTAGCTACAGGGAGATAAGG
AAAGCAACTAAAGAGTTCAGCAGTGTGATTGGCAGTGGGGGGTTTGGGACTGTTCATAGAGGTGAGTTTAGTAATGGGTT
GGTTGCAGCTGTGAAAAGGATGAAGAGGAGCTCTGAACAAGCGGATGATGAGTTTTGCAGAGAGATTGAGCTTCTCGCCA
GGCTGCATCACCGCCATCTAGTTGCTTTGAAAGGCTTTTGTACTAAGAAGAACGAGAGCTTCCTTGTCTACGAGTATATG
GCCAATGGGAGCTTGACGGATCATCTACATTCCACAGAGAAACCTCCACTTAGTTGGGCAACTAGGATGAAAATCGCAAT
CGATGTGGCTAATGCTCTGGAATACCTTCATCTATACTGTGACCCACCTTTATGTCACAGAGACATAAAGTCAAGCAACA
TATTACTCGACGACAACTTTGTTGCTAAGCTTGCAGATTTTGGCCTTGCACATGCTTCAAGAGATGGCTCCGTTTGTTTT
GAACCTATTAATACTGATATCCGTGGAACTCCAGGCTATGTAGATCCAGAGTATGTTGTAACACAAGAACTGACAGAGAA
GAGCGACGTGTACAGCTACGGAGTGGTGTTGCTAGAGATCATAACAGGGAGAAGAGCTGTCGACGAAGGCAGGAATCTGG
TGGAAATGTCACAGCCTTTACTGGTATCAGAATCAAGAAGGGTGGATCTGGTGGATCCGAGAATCAAAGACTGCATAGAC
GGTGAGCAGCTGGAGACAGTGGTGGCGGTTGTGAGATGGTGCACTGAGAAAGAAGGCGTAGCAAGGCCATCGATCAAGCA
AGTCTTGAGGCTGTTGTGTGAGAGCTGTGATCCGTTGCATATGGAGCTTGCAATGGCGGTTGAAGAGCACAAAGGGAGGT
CACTGAGAGGTGGTGGTGACTCAGGGTTGGCTTCTTCCTCTAGTACTACTTCAAGGTCGCATTGTAGCAGGAGTTTCCTG
CTTGAAACTGGCTCTCCACCGAATGGTCTCTCCTTTTGA