Details for Chinese cabbage Locus Brara.E02269

Position : A05 ( 5`- 20696235 .. 20699371 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02269

Protein [Map View]
MFQSLTFFLTVLLIPCFLIFNPSSALKEGETCIVTKNCDQGLHCESCLSSDNFRPRCSRMQTVNPTSKVKGLPYNKYTWL
TTHNSFARIGARSGTGSMILAPSNQQDSITSQLINGVRGFMLDMYDFQNDIWLCHSYGGNCFNYTAFQPALNILHEFQVF
LDKNKDVVVTLIIEDYVKSPNGLGRVFDASGLRNFMFPVTSMPKNGEDWPTIDEMITKNQRMLVFTSNPQKEATEGFAFL
WKYMVENQYGNGGMRPGVCTNRPESAAMGDQSRSLVLVNYFPDTADLMGSCKQNSAPLLDAIQKCQEASGQRWPNFIAVD
FYKRSDGGGAPKAVDVANGRSLCGCDDISACKENMPYGTCEKREEPTKLDSKLMMIAKLTADATKPTQLGLSVFVVTFVS
LLSFFGH*

DNA
ATGTTTCAAAGTCTCACCTTCTTTCTAACAGTTCTTCTCATTCCATGTTTTCTCATCTTTAACCCTTCCTCTGCCCTCAA
GGAAGGAGAAACATGCATCGTGACCAAGAATTGTGATCAGGGACTACACTGCGAATCGTGTCTCTCAAGCGATAATTTTC
GACCTAGATGCTCCCGAATGCAAACCGTTAACCCCACCTCTAAGGTGAAAGGGTTGCCTTACAACAAATACACGTGGTTG
ACAACACACAATTCATTTGCTCGAATAGGTGCAAGATCAGGCACAGGCTCTATGATTCTTGCTCCTTCCAACCAACAAGA
TTCAATCACAAGCCAACTTATTAATGGTGTTAGAGGGTTTATGCTTGACATGTACGACTTCCAGAACGATATATGGCTTT
GCCATTCTTATGGTGGAAACTGCTTCAACTACACAGCGTTTCAACCGGCTCTTAACATTCTACACGAGTTTCAAGTGTTT
CTAGACAAGAACAAGGATGTGGTTGTGACACTTATCATCGAGGACTACGTGAAATCTCCCAATGGTTTAGGCAGAGTGTT
TGATGCATCCGGGTTACGAAATTTCATGTTTCCGGTAACAAGTATGCCTAAGAACGGAGAAGATTGGCCTACCATCGATG
AAATGATAACTAAGAACCAACGGATGCTGGTTTTTACGTCAAATCCTCAAAAAGAAGCTACTGAAGGATTCGCATTTTTA
TGGAAATACATGGTAGAGAATCAATATGGAAATGGAGGCATGAGGCCTGGAGTGTGTACCAATAGACCAGAGTCAGCTGC
TATGGGAGATCAATCTAGATCACTAGTTCTGGTAAACTATTTTCCTGATACTGCGGATTTGATGGGATCTTGTAAACAGA
ACTCTGCTCCTCTTCTTGACGCCATACAAAAATGTCAAGAAGCCTCTGGACAACGCTGGCCTAACTTCATTGCCGTTGAT
TTCTACAAGAGAAGCGATGGTGGAGGAGCTCCAAAAGCAGTTGATGTTGCTAACGGCCGTTCACTTTGCGGCTGTGACGA
TATATCCGCTTGTAAGGAAAACATGCCGTATGGGACGTGTGAGAAACGTGAAGAGCCGACGAAACTGGATTCGAAACTCA
TGATGATTGCGAAACTTACAGCCGATGCTACCAAACCGACCCAACTTGGGCTTTCTGTGTTTGTTGTAACCTTTGTCTCA
CTTCTCTCATTTTTTGGACATTGA