Details for Chinese cabbage Locus Brara.E02265

Position : A05 ( 5`- 20674551 .. 20675819 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02265

Protein [Map View]
MPRSLEPLDLGLQIPYHFRCPISLELMRDPVTVCTGQTYDRTSIESWVSTGNNNTTCPVTRAPLSDHTLIPNHTLRRLIQ
EWCVANRSNGVERIPTPKQPADPTSVRALLSQASAACGTHVSVRSRAAALRRLRAFARDSEKNRVLIAAHNAKEILIRIL
FSDVAPELVSESLALLVIFPMTEPDQCVSIISDPGRVGFLTRLLFDSSIETRVNAAALIEMVVTGTKAADIKGTVLTTEC
IFEGVIDLLRNPTVTSSPRRALKIGVKALFALCLAKNTRCIAVSSGAPEILIDRLAAGLDRCDTERALATVELLCRTPEG
CAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERWREEAVAAGLVVQLLLMVQSECTERAKRKAQKLLKLLR
DSWPDYSFANSDDFGCSEVVPF*

DNA
ATGCCGAGAAGTCTAGAGCCGTTGGATCTAGGACTCCAGATACCGTACCACTTCAGATGTCCAATCTCACTAGAGCTGAT
GCGTGACCCGGTAACCGTCTGCACCGGTCAAACCTACGACCGAACAAGCATCGAGTCATGGGTCTCCACAGGAAACAACA
ACACGACATGTCCAGTCACACGCGCTCCTTTGTCGGACCACACTCTCATCCCGAACCACACCCTCCGCCGCCTCATCCAA
GAATGGTGCGTCGCCAACCGCTCCAACGGCGTCGAGCGCATCCCTACTCCCAAACAGCCCGCCGATCCAACCTCCGTCCG
AGCTCTCCTCAGCCAAGCCTCCGCCGCGTGTGGAACTCACGTCTCCGTTCGCTCCCGCGCCGCCGCTCTCCGCCGTTTGC
GTGCGTTCGCGCGCGATTCCGAGAAGAACCGCGTTTTGATCGCCGCGCACAACGCCAAAGAGATTCTGATCAGGATTCTG
TTCTCCGACGTGGCTCCTGAGTTGGTCTCCGAGTCCCTCGCTCTTCTAGTTATCTTCCCGATGACGGAGCCTGATCAGTG
CGTTTCTATAATCTCGGATCCGGGTCGGGTCGGGTTCCTGACCCGGTTGCTATTTGATTCTTCTATAGAAACGCGCGTTA
ACGCCGCCGCGTTGATAGAGATGGTGGTGACGGGAACGAAGGCGGCTGATATTAAAGGAACGGTTTTAACCACTGAGTGT
ATATTCGAAGGAGTTATCGATCTTCTACGTAATCCTACGGTAACGTCGTCCCCACGGCGAGCTCTCAAGATCGGAGTCAA
AGCGCTGTTCGCGCTCTGCCTCGCGAAAAACACGCGCTGCATCGCGGTATCCTCCGGTGCGCCGGAGATTCTGATCGACA
GACTAGCGGCGGGATTAGACAGGTGCGACACCGAGCGAGCTCTGGCTACGGTGGAGCTGCTCTGCCGGACGCCGGAGGGG
TGCGCGGCGTTCGGTGAGCACGCTTTGACGGTGCCGCTGCTTGTGAAGACGATTCTGAGGGTTTCGGATCGTGCGACGGA
GTACGCGGCGGGGGCGTTGTTAGCGCTTTGCACGGCGGAGGAGCGGTGGAGAGAGGAGGCGGTGGCGGCGGGACTGGTGG
TGCAGTTGCTGCTGATGGTGCAGAGTGAGTGTACGGAGAGGGCGAAGAGGAAAGCGCAGAAGCTGCTGAAGCTTCTGAGA
GACTCGTGGCCTGACTACTCCTTCGCTAACTCCGATGATTTCGGCTGCAGCGAAGTGGTCCCCTTTTGA