Details for Chinese cabbage Locus Brara.E02256

Position : A05 ( 5`- 20615387 .. 20617201 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02256

Protein [Map View]
MGDSASSSSSSSRVFVHNSLGGGSVADLLLWRNRTGAVIVLVSSTVFWFLFERAGYNLLSFVSNVLLLLVAILFLWAKSA
SLLNRPLPPVPNMEIPEEFAVKAADDFRVLINRVLSIASDITVARNPIRLLQMSLVLWAISYVGTLINSLTLVYIGILLS
LSVPLVYEKYQDHIDDKLNSTSKVIRSISMKIPMMPVSKEKKYQ*

DNA
ATGGGCGATTCCGCTTCTTCTTCTTCTTCCTCATCACGCGTTTTTGTTCACAACTCTCTGGGCGGTGGTTCAGTTGCTGA
TTTACTGCTGTGGAGAAACAGGACTGGTGCAGTCATTGTCCTAGTCTCCTCTACTGTGTTCTGGTTTCTGTTTGAGAGAG
CTGGTTACAATCTCTTGTCTTTCGTCTCCAACGTTCTGCTTCTTCTTGTTGCCATCCTCTTCCTATGGGCCAAGTCTGCT
TCCCTACTCAACCGACCTCTACCACCAGTTCCCAATATGGAGATCCCTGAGGAGTTTGCTGTTAAGGCTGCTGATGATTT
TCGTGTTTTGATCAATCGTGTCTTGTCAATTGCAAGTGATATCACCGTTGCTAGAAATCCCATTCGTCTCCTTCAGATGT
CACTGGTCTTGTGGGCGATATCCTATGTGGGGACGTTAATCAACTCCCTCACTCTTGTCTACATTGGGATTCTTCTCAGT
CTTTCTGTTCCTCTTGTCTACGAGAAGTACCAAGACCACATCGACGATAAACTGAACTCGACTTCTAAAGTCATTCGCAG
TATCTCAATGAAGATTCCGATGATGCCCGTAAGCAAAGAAAAGAAGTACCAGTAG