Details for Chinese cabbage Locus Brara.E02255

Position : A05 ( 5`- 20612108 .. 20615212 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02255

Protein [Map View]
MAVLPVGSHFAPPHKLTKRHTVATPSPISLSTRLPQNVSLSKLSGITNSRLSRHSVLVRAEDKIRVSSLEEPSQPLDESE
LEDLLDASGSCDPICSVDEPSSSYFEANYQPKTDIVKALAILAAALTGTAAINHSWVAANQDVAMALLFGIGYAGIIFEE
SLAFNKSGVGLLMAVSLWVVRGIGAPSTEIAVAELQHATAEVSEIVFFILGAMTIVEIVDAHQGFKLVTDNITTRKPKTL
LWVVGFVTFFLSSILDNLTSTIVMVSLLRKLVPQSEYRKLLGAVVVIAANAGGAWTPIGDVTTTMLWIHGQISTLPTIQG
LFIPSAISLAVPLALMSLSSEVNEKGQDSSDVLASEKMAPRGKLVFGVGLGALVFVPVFKALTGLPPYMGILLGLGVLWV
LTDAIHYGESERQKLKVPQALSRIDTQGALFFLGILLSVSSLEAAGILREIANYLDANIPNVELIASAIGVVSAIIDNVP
LVAATMGMYDLTSFPQDSEFWQLVAFCAGTGGSMLIIGSAAGVAFMGMEKIDFFWYFRKVSGFAFAGYAAGIAAYLAIQS
VHFSIPTTVAQIPFLTGS*

DNA
ATGGCGGTGTTACCAGTCGGCTCCCACTTCGCGCCGCCGCACAAACTGACGAAGAGACACACCGTCGCGACTCCATCCCC
TATCTCTCTCTCAACCCGATTGCCTCAAAACGTCTCCCTTTCCAAACTCTCCGGAATAACAAACTCGAGGCTGTCCAGAC
ACAGTGTTCTCGTGAGGGCAGAGGATAAGATCAGAGTCTCTTCTCTCGAGGAACCATCTCAACCACTCGATGAGTCAGAG
CTTGAGGACTTGCTTGACGCATCAGGATCATGTGACCCTATTTGCTCAGTTGATGAACCTAGCTCGAGCTACTTCGAAGC
GAATTATCAACCGAAGACGGATATAGTCAAAGCTCTTGCTATTCTCGCGGCTGCGCTCACAGGAACAGCTGCCATTAATC
ATTCATGGGTCGCTGCTAACCAGGATGTTGCTATGGCGTTGTTGTTTGGAATAGGATACGCTGGAATCATCTTTGAAGAG
TCTTTAGCTTTTAATAAAAGTGGAGTGGGGCTTTTGATGGCTGTTAGTCTGTGGGTTGTGAGGGGCATAGGGGCTCCTTC
AACGGAAATAGCTGTTGCAGAGCTTCAACATGCAACAGCTGAAGTAAGTGAGATTGTGTTTTTCATACTGGGGGCAATGA
CCATTGTGGAGATTGTTGATGCTCACCAAGGTTTTAAGCTGGTTACTGACAATATAACTACCAGGAAGCCAAAGACGCTT
TTGTGGGTGGTGGGGTTTGTGACTTTTTTCCTCAGTTCGATTCTAGACAACTTGACCTCTACCATTGTCATGGTTTCTTT
ACTCAGGAAACTGGTTCCTCAATCTGAATACCGCAAACTTCTAGGAGCTGTTGTGGTGATAGCAGCAAATGCAGGAGGAG
CATGGACTCCAATTGGTGATGTTACTACAACTATGCTATGGATTCATGGTCAGATATCCACCTTGCCGACTATACAGGGT
CTTTTCATACCTTCGGCCATATCTCTTGCTGTTCCGCTAGCCCTCATGTCCTTGAGCAGTGAGGTAAACGAAAAGGGGCA
GGATTCTTCAGATGTACTAGCTTCTGAAAAGATGGCTCCAAGAGGGAAGCTAGTGTTTGGAGTTGGCCTTGGAGCATTGG
TTTTTGTTCCAGTCTTCAAAGCTCTAACTGGATTGCCTCCTTACATGGGCATCTTGTTGGGTCTTGGAGTTCTTTGGGTC
TTGACTGATGCCATCCACTACGGTGAATCAGAAAGACAAAAGCTCAAAGTACCTCAAGCCTTGTCTCGAATCGACACACA
AGGCGCTTTGTTTTTCCTTGGCATCCTTTTATCCGTTAGCAGCCTTGAGGCAGCTGGGATCCTCAGGGAGATTGCAAACT
ACCTTGATGCTAATATACCAAACGTTGAGTTGATTGCTAGTGCAATAGGTGTTGTGTCTGCAATCATAGACAATGTTCCA
TTGGTTGCAGCGACCATGGGGATGTACGACCTCACATCCTTCCCTCAAGACTCTGAGTTTTGGCAGCTGGTTGCGTTCTG
CGCCGGTACTGGTGGTTCGATGCTTATCATTGGTTCCGCTGCTGGTGTGGCCTTCATGGGGATGGAGAAGATAGATTTCT
TTTGGTACTTCCGAAAGGTGAGTGGTTTTGCTTTTGCTGGTTATGCTGCTGGTATCGCGGCTTACCTGGCGATTCAAAGT
GTTCATTTTTCGATCCCAACAACGGTGGCTCAGATCCCATTTCTCACTGGTTCGTAA