Details for Chinese cabbage Locus Brara.E02253

Position : A05 ( 5`- 20607708 .. 20608354 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02253

Protein [Map View]
MKKVLRVYGGVLRLVRLLPADTRPYYAKYARENFVNYRDVDVSETPLDELFQRAYNHSLWVLKKYSIDESAAKKLKEICF
E*

DNA
ATGAAGAAGGTGCTGAGAGTATACGGCGGCGTTTTGAGGCTAGTGCGGCTTTTGCCGGCGGACACAAGGCCCTACTACGC
CAAATACGCGAGGGAGAATTTCGTTAACTACCGTGACGTCGATGTAAGCGAAACACCCCTTGATGAACTCTTCCAACGAG
CTTATAATCACTCACTATGGGTACTCAAAAAGTATTCAATCGACGAATCTGCTGCCAAGAAGCTAAAAGAGATTTGTTTT
GAATGA