Details for Chinese cabbage Locus Brara.E02244

Position : A05 ( 5`- 20507913 .. 20508987 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02244

Protein [Map View]
MALEAMNCPTNSSSFTARKDRNEPTDDLTNDTVFMEPWMKRKRSKRQRSRSPSSSPPRSRPKSQIQDLAEEEYLALCLLM
LANDHHQPKTQPPQESTTKLSHKCSVCGKAFPSYQALGGHKASHRIKPQTTTADDDSTTPTIAVAHPTSTAIAPSGKIHE
CSICHKVFPTGQALGGHKRCHYEGTIGGGGGSKSVSQSGSVTSTVSEERSNRVFIDLNLPALPELSLHHHNTVVDEEIQS
PLTGKKPLLSTDHDKVIIKKEDFSLRI*

DNA
ATGGCTCTCGAAGCGATGAATTGTCCGACGAATTCTTCTTCGTTCACAGCGCGGAAAGATAGAAACGAACCAACAGATGA
TCTGACGAACGACACCGTTTTCATGGAGCCTTGGATGAAACGCAAGCGCTCGAAACGCCAGCGTTCTCGCAGCCCTTCCT
CCTCGCCGCCTCGTTCTCGCCCTAAGTCTCAAATTCAGGATCTTGCGGAGGAGGAGTATCTCGCTCTCTGTCTCCTCATG
CTCGCCAACGACCACCACCAACCCAAGACGCAACCGCCGCAAGAATCCACCACAAAGCTTTCGCACAAGTGCAGCGTTTG
CGGGAAAGCGTTTCCTTCTTACCAAGCTTTAGGCGGCCACAAAGCCAGCCACCGAATCAAGCCTCAAACCACAACCGCCG
ACGACGATTCAACAACTCCAACCATCGCCGTCGCGCATCCGACTTCCACCGCCATCGCACCTTCCGGGAAGATCCACGAG
TGTTCCATCTGCCATAAAGTGTTCCCCACGGGTCAAGCTCTCGGCGGCCACAAACGCTGTCACTACGAAGGAACCATCGG
CGGCGGCGGAGGAAGCAAGTCAGTTAGCCAGAGCGGAAGCGTGACAAGCACGGTTTCGGAAGAACGAAGCAACCGCGTGT
TCATCGATCTAAACCTTCCCGCGTTACCGGAGCTCAGCCTTCATCATCACAACACAGTCGTCGACGAAGAGATTCAAAGT
CCGTTGACCGGTAAAAAACCGCTGTTGTCGACCGATCACGACAAAGTCATCATCAAGAAAGAAGATTTTTCCCTAAGAAT
CTAA