Details for Chinese cabbage Locus Brara.E02231

Position : A05 ( 5`- 20387858 .. 20390373 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02231

Protein [Map View]
MAEANPGRGGGRRGGGPMDDDKLVFETTEGIEPITNFNDMGIKEDVLRGVYEYGFEKPSAIQQRAVMPILQGRDVIAQAQ
SGTGKTSMIALSVCQIVDTSSREVQALILSPTRELASQTEKTIQAIGLHANIQAHACIGGKSVGEDIRKLENGVHVVSGT
PGRVCDMIKRRSLRTRAIKLLILDESDEMLSRGFKDQIYDVYRYLPPDLQVCLVSATLPHEILEMTSKFMTEPVKILVKR
DELTLEGIKQFFVAVEKEEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLSEKMRTNNFTVSSMHGDMPQKERDEIMNQF
RSGDSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDDIKILRDIEQYYSTQIDEM
PMNVADLI*

DNA
ATGGCGGAAGCGAATCCTGGCCGTGGAGGTGGAAGAAGAGGCGGCGGACCAATGGACGACGACAAACTGGTCTTCGAGAC
GACGGAAGGGATCGAGCCCATCACGAATTTCAACGATATGGGGATCAAGGAGGACGTTCTCCGCGGCGTCTACGAGTACG
GTTTCGAGAAGCCCTCCGCGATTCAGCAGAGAGCGGTCATGCCGATTCTCCAAGGCCGCGATGTTATCGCTCAGGCCCAG
TCCGGTACCGGAAAGACCTCCATGATTGCCCTCTCCGTCTGCCAAATCGTTGACACTTCGTCTAGAGAAGTTCAGGCGTT
GATATTGTCGCCAACGAGGGAGCTGGCTTCACAGACGGAGAAGACTATTCAAGCTATTGGATTGCACGCGAATATTCAGG
CGCACGCGTGCATTGGTGGGAAGAGCGTTGGAGAGGATATCAGGAAGCTGGAGAATGGTGTCCATGTTGTGTCTGGGACA
CCTGGTCGTGTTTGTGATATGATTAAGAGGAGGAGTCTGCGTACCAGAGCTATTAAGCTTCTGATTCTTGATGAGTCTGA
TGAGATGCTTAGCAGAGGGTTCAAGGACCAAATCTATGATGTTTACAGATATCTTCCACCTGATCTTCAGGTTTGCTTGG
TTTCTGCAACTCTTCCTCACGAGATTTTGGAGATGACATCAAAGTTTATGACTGAACCAGTGAAGATCCTTGTGAAGCGT
GATGAGTTGACTCTTGAGGGCATTAAACAATTTTTCGTTGCTGTTGAGAAAGAGGAGTGGAAGTTTGATACACTTTGTGA
TCTTTATGACACACTTACTATCACTCAAGCTGTTATCTTCTGCAACACAAAAAGAAAGGTGGATTGGCTAAGTGAGAAAA
TGAGGACTAACAACTTCACAGTCTCATCGATGCATGGTGACATGCCTCAGAAGGAGAGAGACGAGATCATGAACCAGTTT
CGGTCAGGCGACAGTCGTGTTCTGATCACGACAGATGTATGGGCACGTGGGATTGATGTGCAGCAAGTTTCTCTAGTCAT
AAATTATGATCTCCCCAACAACCGTGAGCTCTACATCCACCGTATTGGACGATCTGGTCGTTTCGGGCGTAAGGGTGTTG
CGATCAATTTTGTTAAAAGCGACGACATAAAGATCCTCCGAGACATTGAGCAGTACTACAGTACCCAGATTGACGAGATG
CCAATGAATGTAGCTGATCTTATCTAA