Details for Chinese cabbage Locus Brara.E02219

Position : A05 ( 5`- 20287819 .. 20292455 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02219

Protein [Map View]
MIPQSSSFDFLSHASVSRRLLCPCSNEHGLILFRDRFARRRILRRKTRVQVTNASSRFVSGGDSARKVARSLVVARFSND
FEDEQEPSSSSQIQSDRSSFTNYREDPIVDKLRTQLGVIHPIPSPPINRNAIGLFAFFFFVGVVCDKLWAWRKRRRQDRQ
QRAGPWAQLPSPSFEKDLQRKESVEWVNMVLVKLWKVYRGGIENWLVGLLQPVIDDLKKPDYVKRVEIKQFSLGDEPLSV
RNVERRTSRRVNDLQYQIGLRYTGGARMLLMLTLKFGIIPVVVPVGIRDFDIDGELWVKLRLIPSAPWVGAASWAFVSLP
KIKFELAPFRLFNLMGIPVLSMFLTKLLTEDLPRLFVRPKKIVLDFQKGKAVGPVSEDLKPGDMQEGNKDFVGELSVTLV
NAQKLPYMFSGRTDPYVILRMGDQVIRSKKNSQTTVIGAPGQPIWNQDFQFLVSNPREQVLQIEVNDCLGFADMAIGTGE
VDLGSLPDTVPTDRIVVLQGGWSLFGKGSAGEILLRLTYKAYVEDEEDDKRNAKSINADASDDEMSDSEEPSSFVREKIP
SDDLGPESFMNVLSALILSEEFQGIVSSETGNKLYEGEASVPPVPSKATEDSKSQPDDSGNGGISDLEVKTPSSDRSSVD
DGGLALLWFSVITSVLVLVAINMGGSSFFNP*

DNA
ATGATTCCACAATCTTCTAGCTTCGATTTCTTATCTCACGCTAGCGTCTCACGCCGTCTGTTATGTCCTTGCTCCAACGA
GCACGGCCTGATTCTCTTCCGCGATAGATTCGCGAGGAGGCGGATTCTCCGCCGGAAAACCAGAGTTCAGGTCACGAATG
CGAGCTCGAGGTTTGTTTCCGGCGGGGATTCAGCGAGAAAGGTCGCGAGGAGCCTTGTGGTTGCTCGGTTCTCGAATGAT
TTCGAAGACGAGCAAGAACCATCATCATCGTCACAGATTCAGAGTGACCGAAGCAGTTTCACTAACTATAGAGAAGATCC
GATTGTGGATAAGCTCAGGACTCAGCTAGGCGTTATCCACCCCATCCCCTCCCCGCCGATTAACCGCAACGCGATTGGTC
TCTTTGCGTTCTTCTTCTTCGTCGGTGTTGTTTGCGACAAGCTCTGGGCGTGGAGAAAGAGGCGGAGACAAGATAGGCAA
CAGAGAGCCGGGCCGTGGGCGCAGCTTCCCTCGCCGTCATTCGAGAAGGATTTGCAGAGGAAAGAGTCGGTGGAGTGGGT
GAACATGGTGTTGGTGAAGCTCTGGAAAGTTTACAGAGGTGGGATTGAGAATTGGCTCGTTGGGCTGTTGCAGCCTGTGA
TTGATGACTTGAAGAAGCCTGATTATGTGAAGAGAGTTGAGATCAAGCAGTTTTCGCTTGGGGATGAGCCTTTGTCTGTT
AGAAATGTTGAGAGGAGGACGTCAAGACGCGTCAATGACTTGCAGTACCAGATTGGTCTTAGGTATACTGGTGGTGCTCG
GATGTTGTTAATGCTCACTTTAAAGTTTGGAATCATCCCAGTAGTTGTGCCAGTTGGTATACGAGATTTTGACATCGACG
GTGAGCTTTGGGTTAAGTTAAGATTGATACCGTCAGCGCCTTGGGTTGGAGCTGCATCATGGGCATTTGTATCACTTCCG
AAGATCAAATTTGAGCTGGCACCATTCCGATTGTTTAATCTAATGGGAATTCCTGTTCTATCCATGTTCTTGACCAAACT
GCTGACAGAAGATTTGCCTCGCTTATTTGTCCGGCCAAAGAAAATTGTCTTGGATTTCCAGAAAGGAAAAGCTGTTGGAC
CTGTTTCAGAAGACCTAAAACCTGGAGACATGCAGGAAGGGAACAAAGATTTTGTTGGGGAACTGTCTGTTACTCTTGTA
AATGCCCAGAAACTCCCATACATGTTCTCTGGTAGAACGGATCCGTATGTTATTTTACGAATGGGTGATCAAGTTATCCG
CAGTAAGAAGAATAGTCAAACTACTGTGATTGGGGCTCCTGGTCAGCCAATCTGGAACCAGGACTTCCAATTCCTTGTTT
CAAATCCTAGAGAACAAGTGTTACAAATTGAAGTCAATGACTGTCTTGGATTCGCCGATATGGCTATTGGCACCGGAGAG
GTTGACCTCGGATCACTGCCAGATACGGTTCCTACAGACAGAATTGTTGTTCTGCAAGGCGGTTGGAGTTTATTTGGAAA
GGGATCTGCTGGAGAAATACTACTGCGGCTTACATACAAAGCATACGTGGAGGATGAAGAAGATGATAAACGCAATGCAA
AATCCATTAACGCAGATGCTTCCGATGATGAAATGTCTGATTCCGAAGAACCTAGCTCATTCGTGCGTGAAAAGATTCCT
TCTGACGATCTTGGTCCAGAGTCGTTTATGAATGTGTTGTCTGCATTAATTTTGAGCGAGGAATTTCAAGGCATAGTTTC
ATCAGAAACTGGGAACAAACTTTATGAAGGTGAAGCAAGCGTGCCACCAGTACCCTCAAAGGCTACGGAGGACTCAAAAT
CTCAACCGGACGATTCTGGCAATGGAGGCATATCAGATTTGGAAGTGAAAACCCCGAGTTCTGATAGAAGCTCCGTTGAT
GATGGAGGATTAGCATTGCTGTGGTTCAGTGTAATCACTTCTGTATTGGTGCTCGTTGCTATTAACATGGGCGGCTCAAG
TTTCTTCAACCCGTAA