Details for Chinese cabbage Locus Brara.E02218

Position : A05 ( 5`- 20280874 .. 20286593 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02218

Protein [Map View]
MEGENVTEPLNTAAPSTGESIFATAPPPSDSVLATAASSVSPSSKSQPEQSSMSIATTAQLSANAAASSIANPIPQAPHM
LQNPPFGRPGTLAPPGLMTSPPAFPGSNPFSRPGGPTQINLGVHPHMYPPYHSLPPMHGTPQGMWLQPPPMGGIPRAHFP
SHPTPFPGNYPFPVRGASSHLPYPGSQPLPVGNAGAVHALPGHQPLDVPPGQKPEALSGIDDRAGSQLVGNRVDAWTAHK
SETGVVYYYNSVTGQSTYEKPPGFEREPDKVPVQPIPISMENIRGTDWALVSTNDGKKYYYNNKTKVSSWQIPPEVKDLV
KKTEERSTESLASVPSADLTEKGSEQSSLSAPAINNGGRDAVSLRTTIVPGFSALDLVKKKLHDSGVPVSSTTTSEANGG
KSNEVTPSGESGDGMGKVKDATEGGDLSDSTSDSEDEDSGPSKEECIKQFKEMLKERGVAPFSKWEKELPKIIFDPRFKA
IQSHSVRRSLFEQYVKTRAEEERREKRAAHKAAVEGFKQLLDEASKDIDKHTDYHTFKKKWGNDLRFESLERKEREALLN
ERILSLKRAADQKAQEIRAAAASDFKTMLHEREVSINSHWSKVKDSLRNDPRYRSAAHEDREVFYNEYIAELKAARGDDY
EMKSRGEEDKLRERERELRKRKEREVLEVERVRQKIRRKEAVASYQALLVEKIRDPEASWTESKPKLERDPQKRALNPDL
DPADKEKLFRDHIKTLYERCARDFKALLVEVLSSEAASQQTEEAKTVLNSWSTAKQVLKSDIRYSKMPRDDREVIWRRYA
EDILRKQKQDSPQKEEKPRDYKI*

DNA
ATGGAAGGGGAGAATGTAACGGAGCCGTTGAATACAGCGGCGCCATCTACGGGAGAGAGTATCTTCGCCACAGCTCCTCC
TCCAAGTGATTCAGTATTGGCTACTGCTGCTTCGAGTGTCTCTCCAAGCAGTAAATCTCAGCCGGAGCAATCCTCTATGT
CTATTGCCACTACTGCGCAATTGAGTGCTAATGCAGCAGCCTCCTCAATTGCTAATCCCATACCTCAAGCCCCGCATATG
CTACAGAATCCGCCTTTTGGTCGACCAGGAACACTCGCTCCTCCTGGACTCATGACATCTCCGCCTGCTTTTCCTGGTTC
CAACCCTTTTTCCAGACCCGGGGGTCCTACTCAAATCAATCTTGGTGTTCATCCACACATGTATCCTCCTTATCATTCTC
TGCCGCCAATGCATGGAACGCCTCAAGGAATGTGGCTGCAGCCTCCCCCTATGGGTGGTATTCCCAGGGCGCATTTCCCA
TCACATCCTACTCCTTTTCCTGGTAATTACCCATTTCCAGTTCGTGGAGCTTCTTCTCACCTGCCATATCCCGGTTCTCA
ACCGCTTCCTGTGGGGAATGCTGGCGCTGTTCATGCGTTACCGGGTCACCAACCGTTAGATGTTCCTCCTGGTCAAAAGC
CAGAAGCACTCTCAGGAATTGATGACAGAGCTGGTTCTCAACTAGTAGGAAATCGAGTAGATGCCTGGACTGCACATAAA
TCAGAAACAGGAGTTGTTTACTATTATAATTCGGTTACAGGGCAATCGACCTATGAAAAGCCTCCTGGTTTTGAAAGGGA
GCCTGATAAAGTGCCGGTGCAGCCAATTCCTATCTCTATGGAGAATATACGTGGGACGGATTGGGCTCTTGTTTCCACAA
ATGATGGCAAAAAATATTACTACAACAATAAAACAAAGGTAAGTAGCTGGCAGATTCCACCTGAGGTGAAAGATTTGGTG
AAGAAAACGGAGGAGAGGTCAACGGAGAGTTTAGCTTCTGTGCCGAGCGCTGATTTAACTGAAAAGGGTTCTGAGCAATC
AAGTTTGAGCGCACCTGCTATTAACAATGGTGGCCGGGATGCCGTATCGCTCAGAACTACAATTGTTCCTGGTTTCTCAG
CGTTGGATTTGGTCAAAAAGAAACTGCATGATTCTGGAGTGCCTGTCTCCTCTACGACAACATCTGAAGCAAATGGTGGT
AAATCAAACGAGGTCACACCTAGTGGAGAGAGTGGAGATGGTATGGGCAAGGTAAAAGATGCTACTGAAGGTGGTGACCT
TTCTGATTCTACATCAGATTCCGAAGATGAAGATAGTGGACCATCGAAGGAAGAGTGTATCAAACAGTTTAAGGAAATGC
TCAAGGAGAGAGGAGTGGCACCGTTTTCTAAATGGGAGAAGGAACTGCCAAAAATTATCTTTGACCCTCGCTTTAAGGCA
ATTCAAAGTCATTCTGTTCGAAGATCTTTATTTGAGCAGTACGTAAAGACTCGCGCTGAAGAAGAACGTAGGGAAAAGCG
TGCTGCTCATAAGGCAGCTGTTGAAGGTTTCAAGCAGTTGCTGGACGAAGCGTCTAAGGACATTGATAAACACACTGATT
ATCATACTTTTAAAAAGAAATGGGGAAATGATCTGCGGTTCGAATCACTTGAGCGGAAGGAAAGAGAAGCTTTGCTGAAT
GAAAGAATCCTTTCTTTGAAACGAGCTGCGGACCAGAAGGCGCAAGAAATCCGCGCAGCAGCAGCCTCTGATTTCAAGAC
GATGTTACATGAAAGAGAAGTGTCCATAAATTCACATTGGTCCAAGGTAAAGGATAGCTTGAGAAATGATCCAAGATATA
GATCTGCTGCACACGAGGACAGGGAGGTCTTTTATAATGAGTACATTGCGGAATTAAAAGCTGCAAGGGGAGATGATTAT
GAGATGAAGAGTAGAGGCGAAGAGGATAAACTGAGAGAACGAGAGCGGGAGTTGCGGAAACGGAAAGAAAGAGAAGTGCT
AGAGGTGGAAAGGGTACGACAAAAAATCAGAAGGAAAGAGGCAGTCGCCTCTTATCAAGCTTTGCTAGTGGAGAAGATCA
GAGACCCTGAGGCATCCTGGACAGAATCGAAGCCGAAACTTGAGAGGGATCCACAAAAACGCGCCTTAAATCCGGATTTA
GATCCTGCTGATAAAGAGAAGCTGTTCCGAGACCATATAAAGACATTGTACGAGAGGTGTGCCCGTGACTTTAAAGCTCT
TCTAGTTGAAGTCTTGTCATCGGAAGCTGCTTCTCAGCAGACGGAAGAAGCAAAGACCGTGCTCAACTCTTGGTCGACGG
CTAAACAAGTACTCAAATCCGACATCCGATACAGCAAGATGCCCAGAGATGACAGGGAAGTCATATGGCGCCGATATGCG
GAAGATATCTTGAGGAAACAGAAACAAGATAGCCCTCAAAAGGAAGAGAAACCAAGAGACTACAAGATCTAA