Details for Chinese cabbage Locus Brara.E02213

Position : A05 ( 5`- 20257354 .. 20259629 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02213

Protein [Map View]
MSSSRELQYLEYTYRNNRPTTGLLNSIFMTTVNTAARSLVSVATTASTPELASRRWSASDHLSFASGLLTAAAEKALVPA
SAPSSSSTALVKYSGSADLGTMVCDGVDVPSVNSLGRALCHALALMNEIPVTSRKYQFAMGMAEKIMEENAQSCNVELLD
VNRVALASSFARTTARLHDSLKRSRTADEPVGGLPLRLVSALPLGGYVASYARGVSTCINTVRSLADMTGNLLSQSRRRE
SALVRAGGFQENEVELAVEKLAEELLWMTEKLRRYGAVEEGIKRWSYASGLASLSLTAAPRVQGLLVKISALLIGEMARD
STKVPGQVKFRLLANWLPLFSHARLGLAFPVLTGYERVEVERAIDKAISTLPALDQEILLTNWLQDFSVSATEWPNLTPA
YDRWCNSTRQFVM*

DNA
ATGTCGTCGTCAAGGGAGCTACAATACTTGGAATACACATACAGAAACAATCGTCCCACGACGGGTCTCCTCAACTCCAT
CTTCATGACCACCGTCAACACGGCCGCTCGTTCTCTCGTCTCCGTCGCCACCACCGCCTCCACACCGGAGCTGGCTTCTA
GGCGGTGGTCGGCTTCGGACCACCTCAGTTTTGCTTCGGGTCTTCTTACCGCGGCGGCTGAGAAAGCGTTGGTACCGGCT
TCCGCTCCCTCCTCGTCATCAACGGCGTTGGTGAAGTATTCAGGGTCGGCGGATTTGGGTACGATGGTTTGTGACGGCGT
TGATGTGCCTTCCGTTAACTCTCTCGGTAGAGCACTTTGTCATGCACTAGCGCTAATGAACGAGATTCCAGTAACCTCAA
GAAAGTACCAATTTGCCATGGGAATGGCTGAGAAGATCATGGAAGAGAACGCCCAGAGTTGCAACGTGGAACTACTTGAC
GTAAATCGAGTGGCCCTCGCGTCTTCCTTTGCACGCACCACTGCGCGTTTACATGACTCCTTGAAACGTTCTAGAACCGC
AGACGAACCCGTTGGTGGTCTGCCTCTGCGTCTGGTCAGTGCCCTTCCTCTAGGAGGCTATGTTGCCTCTTACGCGAGAG
GGGTGAGCACGTGCATCAACACGGTGAGGTCCTTGGCGGATATGACTGGTAACTTGTTATCGCAGAGTAGGAGGAGGGAG
TCTGCGTTGGTGAGAGCGGGTGGTTTTCAGGAGAATGAGGTTGAACTGGCGGTGGAGAAGCTGGCGGAGGAGCTGTTGTG
GATGACGGAGAAACTTAGGCGTTATGGTGCGGTGGAAGAAGGTATAAAACGGTGGAGCTACGCTTCTGGTTTAGCTTCCT
TGTCTCTTACGGCTGCTCCTAGAGTGCAAGGCCTCTTGGTTAAGATTTCAGCGCTCTTAATTGGTGAGATGGCACGAGAC
AGTACAAAAGTTCCAGGACAAGTGAAGTTCAGGCTCCTTGCAAACTGGCTACCGTTGTTCAGTCACGCAAGGCTTGGGCT
AGCGTTTCCCGTTCTGACAGGTTATGAGAGGGTTGAGGTGGAACGAGCCATAGACAAGGCGATCTCGACATTGCCTGCAT
TAGACCAAGAGATCTTACTCACAAACTGGCTCCAAGATTTCTCAGTCTCCGCCACTGAGTGGCCCAATCTCACCCCAGCG
TACGACCGTTGGTGCAACTCCACTCGCCAGTTTGTCATGTAG