Details for Chinese cabbage Locus Brara.E02211

Position : A05 ( 5`- 20241506 .. 20243499 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02211

Protein [Map View]
MSSGGNSAASTAPAVEKMFFCYQCNHTVNISISSAADPFCPLCSGGFLEEYDEPVPTLPANLNPAASDFFPMADPFSTLL
PLLFGSSSAPPPSSANPSFFGPRSAQNHPQGGAFDPFSFLQNHLQHLQSSGTHVQFLIEDHPLDPSNQAPGHLGDYFFGP
GLEQLIQQLAENDPNRYGTPPASKSAIEGLPTVKVSKDMLKSEMNQCAVCMDEFEDGGDVKQMPCKHVFHQDCLMPWLEL
HNSCPVCRYELPTDDPDYESRGQGQGGQTSGDGGQTPRSFSVQLPWTFGGRRDGSGSGAPGSGAGGGGGSNPGTRQEDLD
*

DNA
ATGTCTTCCGGCGGAAACTCAGCAGCCTCCACCGCCCCCGCGGTCGAAAAGATGTTCTTTTGCTACCAGTGCAACCACAC
AGTCAACATCTCAATCTCCTCCGCCGCCGATCCTTTCTGCCCTCTTTGCTCCGGCGGCTTTCTTGAAGAATACGACGAAC
CCGTCCCTACTCTACCCGCGAATCTCAACCCCGCCGCCTCCGATTTCTTCCCCATGGCCGATCCTTTCTCCACCTTGCTC
CCTCTCCTCTTCGGCTCCTCCTCCGCCCCTCCTCCTTCCTCCGCAAACCCGAGCTTCTTCGGACCCCGCTCTGCCCAGAA
CCACCCTCAAGGCGGCGCCTTTGATCCGTTTTCCTTCCTCCAGAACCATCTCCAGCATCTCCAATCCAGCGGCACGCACG
TGCAGTTCTTGATCGAGGATCATCCTCTGGATCCCTCTAACCAAGCCCCGGGGCATCTCGGGGACTACTTCTTTGGCCCT
GGTCTCGAGCAGCTGATCCAGCAGCTCGCGGAGAACGATCCCAACCGTTACGGAACTCCTCCGGCTTCGAAGTCGGCTAT
CGAGGGGCTGCCGACTGTTAAGGTGAGTAAGGATATGCTGAAGTCTGAGATGAACCAGTGTGCTGTTTGTATGGATGAGT
TTGAGGATGGTGGCGATGTGAAGCAGATGCCTTGCAAGCATGTGTTTCATCAGGATTGTTTGATGCCGTGGCTTGAGTTG
CATAACTCTTGTCCGGTTTGTCGGTATGAGTTGCCTACGGATGATCCTGATTATGAGAGTAGGGGTCAGGGGCAAGGAGG
TCAGACGAGTGGGGATGGTGGGCAGACTCCGAGGAGCTTTAGTGTACAGCTTCCTTGGACGTTTGGTGGGAGACGGGATG
GTTCAGGGTCAGGAGCACCTGGAAGTGGTGCTGGTGGTGGAGGTGGTTCTAATCCTGGGACCAGGCAGGAAGATTTGGAT
TGA