Details for Chinese cabbage Locus Brara.E02210

Position : A05 ( 5`- 20231693 .. 20238648 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02210

Protein [Map View]
MSQKVTPSMVSLKSLPADYRFDGENSSRASVGLRNGVSQAGDSEDSPYSGHGVSLEEQSLTDDVDPGAATMPLPQSDERR
WSDTSAYARKKVLQSWVQLPNGNWELGKILSTSGEESVISLPEGKVIKVISETLVPANPDILDGVDDLMQLSYLNEPSVL
YNLNYRYNQDMIYTKAGPVLVAVNPFKEVPLYGNRYIEAYRKKSNESPHVYAIADTAIREMIRDEVNQSIIISGESGAGK
TETAKIAMQYLAALGGGSGIEYEILKTNPILEAFGNAKTLRNDNSSRFGKLIEIHFSESGKISGAQVQTFLLEKSRVVQC
AEGERSYHIFYQLCAGASPGLREKLNLTSAHEFKYLGQSNCYSINGVDDAERFHSVKEALDIVHVSKEDQESVFAMLAAV
LWLGNVSFTVIDNENHVEPVADESLSTVAKLIGCNINELKLSLSKRNMRVGKDTIVQKLTLPQAIDARDALAKSVYSCLF
DWLVEQINKSLAVGKRRTGRSISILDIYGFESFDQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWTRVDFEDNQDCL
SLFEKKPLGLLSLLDEESTFPNGTDLTLANKLKQHLHSNSCFRGDREKLFTVVHYAGEVTYDTTGFLEKNRDLLHLDSIQ
LLSSCSCHLPQAFASSMLIQSEKPVVGPLYKAGGADSQRLSVATKFKGQLFQLMQRLGNTTPHFIRCIKPNNVQSPGLYE
QGLVLQQLRCCGVLEVVRISRSGFPTRVSHQKFARRYGFLLVENIADKDPLSVSVAILHQFNILPEMYQVGYTKLFFRTG
QIGVLEDTRNRTLHGILRVQSSFRGYQARCHLKELKMGISILQSFVRGDKVRKEFAELRRRHRAAATIQSQVKSKFARKQ
YKGITDASVLIQSAIRGWLVRRCSGDLRWLKSVGTKTNESGEVLVKASVLSDLQRRVLKSEAALREKEEENDILQQRLQQ
YENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNSDASVNASDATDWDSSSNQFKSQASNGGGGRQQQQ
PMSAGLSVIGRLAEEFEQRAQVFGDDAKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKMILSKLGSEE
SSGSMEKVKRKWWGRRNSTRY*

DNA
ATGTCCCAAAAGGTGACTCCATCCATGGTGTCTCTTAAATCTTTGCCAGCAGACTACAGATTCGATGGTGAAAATTCTTC
TAGAGCGAGTGTTGGCTTGAGGAATGGTGTTAGTCAAGCTGGAGATAGTGAGGATTCACCATATAGTGGTCACGGTGTGT
CCCTTGAAGAGCAGTCTTTAACTGATGATGTGGATCCTGGTGCTGCTACAATGCCCTTGCCTCAGAGTGATGAACGCAGG
TGGAGTGATACTAGCGCATATGCTCGGAAGAAGGTACTGCAATCTTGGGTTCAACTTCCAAATGGTAACTGGGAGCTTGG
GAAGATACTGTCAACTTCAGGAGAAGAGTCTGTTATCTCTTTGCCAGAGGGAAAAGTTATAAAAGTTATATCAGAGACTC
TAGTACCTGCAAATCCTGATATTCTTGATGGAGTGGATGATCTAATGCAACTAAGTTACTTAAATGAGCCATCAGTGTTG
TACAATCTCAACTATAGGTACAACCAAGACATGATATATACAAAAGCAGGGCCGGTTTTGGTGGCTGTGAATCCTTTCAA
GGAGGTTCCTTTGTATGGAAATCGCTACATTGAAGCATACAGGAAGAAATCAAATGAAAGTCCTCATGTGTATGCCATTG
CAGATACAGCAATTCGTGAAATGATACGCGATGAGGTTAACCAATCTATCATTATCAGCGGCGAGAGTGGAGCAGGGAAA
ACTGAGACAGCTAAGATCGCTATGCAATACTTGGCTGCTCTAGGAGGTGGAAGCGGGATCGAGTATGAGATACTTAAGAC
TAATCCCATTTTGGAAGCATTTGGAAATGCTAAAACTTTGAGAAATGATAACTCTAGTCGTTTTGGGAAGCTGATAGAGA
TTCATTTTAGTGAAAGCGGAAAGATATCGGGTGCTCAAGTTCAGACCTTTTTACTAGAAAAGTCTAGAGTGGTTCAATGT
GCTGAAGGGGAAAGGTCATACCATATATTTTACCAACTTTGTGCTGGGGCTTCACCTGGACTTAGAGAGAAGCTAAATCT
GACAAGCGCACATGAGTTTAAATACTTGGGACAGAGTAACTGTTATTCAATCAATGGAGTTGATGATGCTGAACGTTTTC
ATAGTGTTAAGGAAGCTCTTGACATTGTTCATGTTAGTAAAGAAGATCAAGAAAGTGTGTTCGCAATGCTTGCTGCAGTG
TTATGGCTGGGGAATGTTTCCTTCACCGTTATTGACAATGAAAACCATGTTGAGCCTGTGGCAGATGAAAGTTTGTCAAC
TGTTGCTAAATTAATTGGGTGCAACATCAATGAGCTTAAGCTAAGTTTATCGAAACGTAACATGAGAGTTGGAAAAGATA
CCATTGTGCAGAAGCTAACACTACCGCAGGCCATTGATGCAAGAGATGCTTTAGCAAAATCGGTTTATTCGTGCCTGTTT
GACTGGCTGGTTGAACAGATCAACAAGTCTCTTGCAGTGGGGAAGAGGCGAACTGGGAGATCCATCAGCATTCTTGATAT
CTATGGCTTCGAATCATTTGATCAGTTCTGTATAAATTATGCAAATGAGAGATTGCAGCAACACTTTAACCGTCATCTAT
TCAAGCTGGAGCAAGAGGAATATATCCAAGATGGTATTGACTGGACAAGGGTTGATTTTGAGGACAACCAAGATTGTCTG
AGTCTCTTTGAAAAGAAACCATTGGGGCTGCTTTCTCTTTTGGACGAGGAATCAACATTTCCGAATGGCACAGATTTGAC
ACTTGCAAACAAGCTAAAACAGCATCTACACTCTAATTCATGTTTCAGAGGAGATCGAGAGAAGCTTTTCACAGTTGTGC
ATTATGCAGGAGAGGTTACATATGACACAACAGGATTTCTAGAGAAGAACAGAGACCTGTTGCACTTGGATTCTATTCAG
CTTTTGTCCTCTTGCTCGTGCCACCTTCCTCAAGCGTTTGCTTCTAGCATGCTGATCCAATCCGAAAAACCTGTAGTCGG
TCCTTTGTACAAAGCAGGTGGTGCTGATTCCCAGCGGTTGAGTGTAGCTACCAAATTTAAGGGTCAACTATTCCAATTGA
TGCAACGTTTAGGGAACACTACCCCACATTTCATTCGTTGCATCAAGCCAAATAACGTTCAGTCTCCAGGGTTGTATGAG
CAAGGACTTGTCTTACAGCAGCTAAGATGTTGTGGGGTCTTAGAAGTGGTTCGAATCTCACGGTCTGGATTTCCTACAAG
AGTGTCTCATCAGAAATTTGCCAGAAGGTATGGTTTCCTTCTGGTGGAGAACATTGCTGATAAAGATCCTCTAAGTGTCT
CAGTTGCGATCCTCCATCAGTTTAATATCTTGCCGGAGATGTACCAAGTTGGCTACACGAAGTTGTTTTTCAGAACCGGA
CAGATTGGGGTTCTTGAAGATACAAGGAACCGTACACTCCATGGCATTTTACGTGTCCAAAGCTCTTTTAGAGGATACCA
AGCACGATGTCACCTGAAGGAGCTTAAAATGGGGATATCCATTCTTCAGTCATTTGTTCGTGGAGATAAAGTAAGAAAAG
AGTTTGCCGAGTTACGAAGGAGGCATAGGGCTGCAGCTACTATACAAAGCCAAGTTAAAAGCAAGTTTGCTAGGAAACAG
TATAAGGGTATAACCGATGCGTCGGTTTTGATACAGTCAGCAATTCGTGGTTGGTTGGTTAGAAGATGCTCAGGAGATCT
TAGATGGCTAAAATCTGTAGGCACTAAGACAAATGAGTCAGGCGAGGTACTAGTGAAGGCATCTGTACTTTCCGACCTTC
AACGTAGAGTACTTAAATCTGAAGCTGCTCTGCGTGAGAAAGAAGAGGAGAACGACATTCTTCAACAGAGGCTTCAACAG
TACGAGAACCGTTGGTCAGAATACGAGACAAAGATGAAATCAATGGAAGAAATCTGGCAGAAGCAAATGCGGTCTTTGCA
ATCTAGTCTCTCCATAGCAAAGAAAAGCCTAGCGGTCGAGGACTCTGCTAGAAACTCGGATGCATCGGTCAATGCAAGTG
ACGCAACGGATTGGGATTCAAGCAGTAATCAGTTCAAGAGTCAGGCAAGCAACGGAGGAGGGGGGAGACAACAACAACAG
CCTATGAGTGCTGGTCTTAGTGTGATTGGACGGTTGGCGGAGGAGTTTGAACAGAGAGCTCAAGTGTTTGGTGATGATGC
GAAGTTCTTGGTGGAAGTGAAGTCTGGTCAGGTGGAAGCGAACTTGAACCCAGACAGAGAGCTGAGGAGGTTGAAACAGA
TGTTTGAGACGTGGAAGAAGGATTATGGAGGGAGGTTGAGGGAAACGAAGATGATACTGAGCAAGCTTGGGAGTGAAGAG
AGCAGTGGTTCGATGGAGAAGGTGAAGAGGAAGTGGTGGGGAAGGAGGAATAGCACTAGGTATTGA