Details for Chinese cabbage Locus Brara.E02198

Position : A05 ( 5`- 20152199 .. 20155518 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02198

Protein [Map View]
MGRVLVMLTAATAVVACSVATVMVRRRVKRRRKWRKVVGLLKDLEESFETPLGRLRQMVDAIAVEMQAGLVSEGGSKLKM
LLTFVDDLPNGSERGTYYALHLGGSYFRIIRVHLGGQRSSLEVQDIERHSIPTSLLNSTSEVLFDFLASSLQRFIEKEGH
ESISSQDVKRELAFTFSFPVKQTSLSSGVLIKWTKGFAISEMAGEDIAECLQGAVDRRGLDIHVAALVNDTVGALSYGHY
HDPDTIAAVVFGTGSNACYLERTDAIIKCQNPRTTSGSMVVNMEWGNFWSSRLPRTSYDIELDAESLNSNDMGFEKMIGG
MYLGDIVRRVILRMSQESDIFGPISSILSTPFVLRTNSVSAMHEDDTPELHEVATILKHLGVPKVPLKVRKLVVKICDVV
TRRAARLAAAGISGILKKLGRDGSVGEGRRRSSDKQMMRRTVVAVEGGLYSNYRMFREYLDEALSDILGEDVARQVVIKA
MEDGSSIGSALLLASSHSVRTISNI*

DNA
ATGGGGAGGGTTCTGGTGATGCTGACGGCAGCCACGGCGGTTGTGGCTTGTTCGGTGGCGACGGTGATGGTGAGGAGGAG
GGTGAAACGTCGGAGGAAGTGGAGGAAGGTGGTGGGGCTATTGAAGGATTTGGAGGAATCGTTTGAGACGCCGTTGGGGA
GGTTGAGGCAGATGGTGGATGCTATTGCTGTGGAGATGCAAGCTGGTTTGGTCTCTGAAGGAGGGTCTAAGCTTAAAATG
CTCCTCACTTTCGTCGATGATCTTCCTAATGGGAGTGAGAGAGGAACTTATTACGCACTTCATCTTGGAGGCTCTTACTT
TAGGATCATAAGAGTTCATTTGGGTGGCCAAAGGTCGTCTCTTGAAGTTCAAGATATAGAAAGGCATAGCATACCGACGT
CTTTGTTGAATAGCACCAGCGAGGTTCTCTTCGACTTTCTCGCATCATCTTTGCAGAGGTTTATTGAGAAAGAAGGACAC
GAGTCCATTTCTTCACAAGATGTGAAAAGGGAACTTGCGTTTACTTTTTCTTTCCCAGTTAAGCAAACTTCCCTCTCTTC
TGGAGTTCTCATCAAATGGACCAAAGGTTTCGCAATTAGTGAAATGGCTGGGGAAGATATTGCTGAATGTCTACAAGGAG
CGGTGGACAGGAGAGGGCTGGATATACACGTCGCAGCTCTTGTGAATGATACAGTTGGGGCCCTGTCCTATGGACATTAT
CATGACCCAGACACGATTGCCGCTGTTGTCTTTGGAACAGGTAGTAATGCTTGTTACCTCGAACGCACTGATGCCATAAT
CAAGTGTCAGAATCCGCGCACAACTTCTGGAAGCATGGTGGTGAACATGGAGTGGGGAAACTTTTGGTCATCTCGTCTTC
CAAGAACTTCATATGACATTGAGTTGGATGCAGAGAGTTTGAATTCAAATGACATGGGATTTGAGAAGATGATAGGAGGG
ATGTATCTGGGCGACATTGTCCGCAGAGTAATTCTTCGTATGTCACAAGAGTCTGACATCTTTGGACCCATCTCATCCAT
TTTATCGACGCCTTTTGTTCTAAGAACAAATTCAGTCTCAGCAATGCACGAAGATGACACACCCGAGTTACATGAAGTAG
CAACAATCTTGAAACATTTAGGGGTACCGAAGGTACCACTGAAGGTGAGGAAACTTGTAGTGAAGATATGCGATGTAGTG
ACACGCAGAGCAGCTAGGCTAGCAGCAGCAGGAATATCAGGAATCTTGAAGAAACTGGGGAGAGATGGGAGCGTAGGAGA
AGGAAGAAGAAGAAGTAGCGATAAGCAGATGATGAGAAGGACAGTGGTGGCAGTAGAAGGTGGTCTCTATTCGAATTATA
GGATGTTCAGAGAATACCTGGACGAAGCTTTGAGTGACATATTGGGAGAAGACGTGGCTCGACAAGTAGTGATTAAGGCC
ATGGAAGATGGCTCAAGCATCGGCTCTGCATTGTTGCTGGCTTCGTCCCATAGTGTTCGAACCATATCGAACATATAA