Details for Chinese cabbage Locus Brara.E02197

Position : A05 ( 5`- 20149139 .. 20152485 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02197

Protein [Map View]
MLVDDIGDVTITNDGATILRMLEVEHPAAKVLVELAELQDREVGDGTTSVVIVAAELLKRANDLVRNKIHPTSIISGYRL
AMREACKYIEEKLVTKVEKLGKAPLINCAKTSMSSKLISGDSDFFANLVVDAVLSVKMTNQRGEIKYPIKGINILKAHGQ
SAKDSYLLNGYALNTGRAAQGMPLRVSPAKIACLDFNLQKTKMQLGVQVVVNDPRELEKIRQREADMTKERIEKLLKAGA
NVILTTKGIDDMALKYFVEAGAIAVRRVRKEDMRHVAKATGATLVTTFADMEGEETFDPAHLGSADEVVEERIADDDVVL
IKGTKTSSAVSLILRGANDYMLDEMERALHDSLCIVKRTLESNTVVAGGGAVESALSVYLEHLATTLGSREQLAIAEFAD
ALLIIPKVLAVNAAKDATELVAKLRAYHHTAQTKADKKHYSSMGLDLVNGTIRNNLEAGVIEPAMSKVKIIQFATEAAIT
ILRIDDMIKLVKEDGQGDE*

DNA
ATGTTGGTGGATGATATTGGTGATGTGACCATTACAAATGACGGTGCTACCATCCTTAGGATGCTGGAGGTTGAACACCC
TGCTGCGAAGGTTCTTGTTGAGTTAGCTGAACTCCAGGATAGAGAAGTTGGTGATGGGACTACATCTGTTGTCATTGTTG
CTGCTGAGTTGCTCAAGAGGGCAAATGATCTTGTCAGGAACAAAATACATCCTACATCAATTATCAGTGGATACAGGCTA
GCGATGAGGGAAGCTTGCAAATACATTGAAGAAAAATTGGTGACTAAGGTCGAAAAGCTTGGGAAAGCTCCATTGATTAA
CTGTGCTAAAACCAGCATGTCCTCCAAACTGATCTCTGGTGACAGTGACTTCTTTGCCAATTTGGTTGTGGATGCAGTTC
TGTCAGTTAAGATGACAAATCAGCGAGGGGAGATAAAATACCCTATCAAGGGGATTAATATTCTGAAAGCTCATGGACAA
AGTGCAAAAGACAGCTATCTGTTGAATGGATATGCACTCAACACTGGCCGTGCTGCCCAAGGGATGCCATTGCGAGTTTC
TCCAGCGAAGATTGCTTGCCTCGACTTTAATCTTCAGAAGACGAAAATGCAGCTGGGTGTCCAAGTTGTTGTAAACGACC
CACGAGAACTTGAAAAAATCCGTCAAAGAGAAGCTGACATGACCAAAGAGCGGATAGAGAAACTTCTTAAAGCTGGGGCC
AATGTTATTCTGACCACCAAGGGAATTGACGACATGGCACTTAAATACTTTGTAGAGGCAGGAGCTATTGCTGTTAGGCG
TGTCCGCAAAGAAGACATGCGCCATGTTGCGAAAGCAACAGGAGCAACTCTGGTCACCACTTTTGCTGACATGGAGGGGG
AAGAAACATTTGATCCGGCACACCTTGGATCTGCAGACGAAGTTGTGGAGGAGAGAATCGCAGATGATGATGTTGTGTTG
ATAAAGGGAACGAAAACAAGCAGTGCGGTCTCCTTGATCTTGAGAGGTGCGAATGACTACATGCTTGATGAGATGGAGAG
AGCACTGCACGATTCTTTATGTATTGTCAAGAGGACCCTCGAATCAAACACGGTGGTTGCAGGTGGAGGTGCAGTAGAAT
CAGCGTTGTCTGTGTATCTGGAGCACCTTGCTACAACCTTGGGCTCTCGTGAACAATTGGCTATTGCTGAATTTGCAGAT
GCGCTATTGATTATACCAAAGGTACTTGCAGTAAACGCTGCCAAGGATGCAACCGAGTTGGTAGCTAAACTAAGAGCATA
CCACCACACCGCACAAACCAAGGCTGATAAGAAGCACTATTCAAGCATGGGACTTGACCTTGTTAACGGAACCATCCGTA
ACAATTTGGAAGCTGGAGTGATCGAACCAGCGATGAGCAAAGTGAAAATCATCCAGTTTGCAACAGAGGCAGCCATTACC
ATTCTGCGAATTGATGACATGATCAAACTGGTGAAGGAAGATGGCCAAGGCGATGAGTAA