Details for Chinese cabbage Locus Brara.E02196

Position : A05 ( 5`- 20147206 .. 20148173 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02196

Protein [Map View]
MAAVNGYQGNTPAETTPAAAGSKQPAPPTKTVDSQSVLKRLQSELMGLMMGGDPGISAFPEEDNIFCWKGTITGSKDTVF
EGTEYRLSLSFSNDYPFKPPKIKFETCCFHPNVDLYGNICLDILQV

DNA
ATGGCGGCGGTGAATGGGTACCAAGGAAATACTCCGGCGGAGACAACGCCGGCAGCCGCCGGATCGAAGCAACCTGCTCC
TCCGACTAAGACCGTCGATAGCCAATCCGTTCTCAAAAGGCTGCAATCTGAACTAATGGGTTTAATGATGGGAGGTGATC
CAGGGATATCGGCTTTCCCAGAGGAAGACAACATATTCTGCTGGAAAGGGACAATCACAGGAAGCAAAGATACTGTGTTT
GAAGGAACTGAGTACAGACTCTCACTCTCTTTCTCCAACGATTATCCTTTCAAACCTCCCAAAATTAAGTTTGAGACTTG
CTGCTTCCACCCCAATGTGGATCTCTATGGCAATATTTGCTTGGACATTCTTCAGGTA