Details for Chinese cabbage Locus Brara.E02175

Position : A05 ( 5`- 19915558 .. 19919244 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02175

Protein [Map View]
MDVGVAASNGGEPMSPPPPPAKKRRFGEEMNRVAEIVLVLSALGRMRGGKAPTEMELELMVEARSKLAEMCQEFTPNDII
GGDDVRAVIEDMGLNGKDQRLGFRAPKITISEKLSLGKRKMEEAKQFPTPMVSHLSRPNNGIASPGLGKNVSVANKGVSS
DVTSVNPAGSYLRPKMMLNGAASQGTANSSANYYAGSWSTQPQSTISFGTAPSKKVPIQSSARVPDPSFRPFMSQTPHGT
SPGTNQPMQGVHYGQTYSFQNNHSDIAKIVYNFLHPRVKQYPVWNPPSRDYMSRAMTCQMCEVTINEVATLLICDACENA
YHLKCMQANNLKGVPKSEWHCSKCVLASNGKPFPPKYGRAVTTKKVGSMDTKVNLQKPIVTTGPRVQNLPGFVSGAATTS
HSVTASVNANTTASAAKTTNTGTQGFRESLVGCTNSPALVSLTKTPNPTAIGSKSVLINNGFVSKPLTPASTMSSPSQLP
VVNLVTVNAISNATSSTPVTSSLVAEAPSVTKNGNGNSSASGTTDHSMLNTELTALEALSVTSSGNSHPEVSHSETTKTT
EDEATGQSLNADDGLQAPLENVSSCENPSESTSQSDSLNDKTTPENGLEPGKDASEKFASEPCQNHPTETPTAVVSDQDS
KMTAEPFMPEDNSACQTEDTSSQPPSVSSYSHSQTEKETPNAQDTVQNVPGDSQEGKGLNGLDDRHHEQPSDP*

DNA
ATGGATGTGGGTGTGGCGGCTAGTAACGGAGGAGAACCAATGTCTCCTCCTCCTCCTCCTGCGAAAAAGCGACGCTTTGG
CGAAGAGATGAACAGAGTGGCGGAGATTGTGCTGGTTTTGTCGGCGTTAGGGAGGATGCGAGGAGGGAAAGCCCCGACGG
AGATGGAACTCGAGCTGATGGTTGAAGCTAGGTCGAAACTAGCGGAGATGTGCCAAGAGTTTACTCCTAATGATATCATC
GGTGGCGATGATGTTAGAGCTGTGATTGAAGATATGGGTTTGAATGGTAAAGACCAGAGATTAGGATTCCGAGCTCCTAA
GATCACTATCTCCGAGAAGCTGTCTCTTGGCAAAAGAAAGATGGAAGAAGCAAAACAGTTTCCGACACCTATGGTATCCC
ACTTGTCACGGCCTAACAATGGTATTGCGTCTCCAGGTCTTGGAAAGAATGTTTCGGTGGCTAATAAGGGGGTTAGTAGT
GATGTTACTAGTGTTAATCCAGCTGGGAGCTATCTCAGGCCTAAGATGATGCTTAATGGTGCTGCTTCTCAGGGTACTGC
AAATTCTTCTGCAAATTACTATGCTGGATCCTGGTCTACCCAACCTCAATCAACCATATCATTCGGTACTGCACCAAGTA
AGAAGGTGCCTATTCAAAGCTCTGCCAGGGTACCAGATCCAAGCTTTAGGCCATTCATGTCTCAAACTCCACACGGTACA
TCCCCGGGCACAAACCAGCCGATGCAAGGAGTCCATTACGGTCAGACTTATTCGTTTCAGAACAACCATAGTGACATCGC
TAAGATAGTCTATAATTTTCTGCATCCACGGGTCAAACAGTATCCTGTGTGGAACCCACCTTCCAGAGATTATATGAGCA
GAGCAATGACATGCCAGATGTGTGAAGTTACCATCAATGAAGTGGCGACTCTACTGATTTGTGATGCCTGTGAAAATGCA
TACCACTTGAAATGTATGCAGGCAAACAATTTGAAAGGGGTTCCAAAATCTGAATGGCATTGCTCAAAATGTGTGCTTGC
ATCCAATGGGAAGCCGTTCCCTCCTAAGTATGGCCGTGCTGTAACTACAAAGAAGGTTGGATCAATGGATACTAAGGTTA
ATCTACAGAAACCAATTGTGACTACGGGTCCCAGGGTACAGAATCTTCCTGGCTTTGTTTCTGGAGCAGCAACTACATCT
CATTCTGTGACTGCTAGTGTGAATGCAAATACAACTGCAAGCGCAGCAAAGACCACAAACACTGGGACACAAGGCTTTAG
GGAAAGTCTTGTCGGTTGTACCAATTCTCCAGCACTGGTATCTCTTACCAAGACTCCAAATCCTACAGCAATTGGAAGTA
AAAGTGTTTTGATAAACAATGGCTTCGTTTCAAAACCTCTAACACCAGCTAGCACTATGAGCAGCCCTTCTCAATTGCCT
GTTGTTAACCTGGTTACCGTGAACGCAATCTCAAATGCTACTTCGAGTACACCAGTAACTTCTAGCCTTGTAGCAGAAGC
ACCATCAGTTACCAAAAATGGAAACGGTAACTCAAGCGCCTCTGGTACGACTGACCATTCTATGCTAAATACCGAGCTTA
CGGCACTTGAGGCATTGTCTGTTACTTCCAGTGGCAATTCTCATCCGGAAGTGTCACATTCTGAGACTACAAAAACAACT
GAAGATGAAGCTACAGGTCAATCATTGAATGCTGATGATGGTCTACAAGCTCCTCTGGAAAATGTTTCTAGCTGTGAGAA
TCCATCAGAGTCTACATCTCAGTCAGACTCTCTGAATGATAAAACAACACCAGAGAACGGGCTAGAACCAGGCAAGGATG
CCAGTGAGAAATTTGCTTCTGAACCTTGCCAGAACCACCCAACAGAAACTCCAACTGCAGTTGTATCAGATCAAGACTCG
AAGATGACTGCTGAACCATTCATGCCAGAAGATAATTCAGCTTGCCAGACAGAGGATACATCGTCTCAGCCTCCTTCAGT
GTCATCTTACTCTCATTCACAAACCGAGAAAGAAACACCAAATGCTCAAGATACTGTACAGAATGTCCCAGGAGATTCGC
AAGAAGGCAAAGGGTTGAATGGTCTAGATGATAGACATCATGAACAGCCTTCAGATCCTTAG