Details for Chinese cabbage Locus Brara.E02169

Position : A05 ( 5`- 19893901 .. 19894401 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02169

Protein [Map View]
MGNCLRHESEMHWAGEDWDDFITQDEEHHYHNSKKTSTKARKTVTVKRESKSCDPSHHEIKIRLTRKQLQDLLNKVNVHD
STGYAAPDIDRTNQEGNQYRLWKPVLQSIPEVD*

DNA
ATGGGGAATTGTCTAAGACATGAGTCAGAAATGCACTGGGCTGGTGAAGATTGGGATGATTTCATCACACAAGATGAAGA
ACATCACTATCATAACTCCAAGAAGACCTCCACCAAAGCTAGAAAAACAGTAACAGTTAAACGAGAAAGTAAATCATGTG
ATCCGTCTCATCATGAGATCAAGATCAGGCTCACGAGGAAGCAACTCCAAGATTTACTTAATAAAGTCAACGTCCATGAC
TCGACCGGTTATGCAGCGCCTGATATTGATCGTACAAATCAAGAAGGCAACCAGTACCGGTTATGGAAACCAGTTTTGCA
GAGCATACCAGAGGTTGACTGA