Details for Chinese cabbage Locus Brara.E02162

Position : A05 ( 5`- 19835092 .. 19841602 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02162

Protein [Map View]
MVSLSNQTSFSFYPNNLFVSDKTRLGIPGINFPRKIKVKVACFAADQPRQQKQQKKKKSQSTNSDADSGVDPVGFLTKLG
IADRIFAQFLRERHKAIKDLKDELLKRHFDLRDLASGFELLGMHRHMEHRVDFIDWGPGARYGAIIGDFNGWSPTENSAR
EGLFGHDDFGYWFIILEDKLREGEEPEELYFQQYNYVDDYDKGDSGVTAEEVFQRANDEYWEPGEDRFIKNRYEVPAKLY
EQLFGPNSPQTLEDLGEIPDAETRYKQYKEEHKNDPPSNLPPCDIIDDGRGKPYDIYNVVTSPEWTKKFYEKSPPIPYWL
ETRKGRKAWLEKYIPAVPHGSKYRLYFNTPDGPLERVPAWATYVQPEDEGKQAYAIHWEPSPESAYKWKHSKPDKPKSLR
IYECHVGISGSEAKISSFEEFTKKVLPHVKRAGYNAIQLIGIPEHKDYYTVGYRVTNFFAVSSRYGTPDDFKRLVDEAHG
LGLLVFLDIVQSYAAADQMVGLSLFDGSNDCYFHHGKRGHHKHWGTRMFKYGDLDVFHFLISNLNWWITEYQVDGYQFHS
LASMIYTHNGFAPFNSGFDDYCNQYVDRDALMYLILANEILHDLHPDIITIAEDATYYPGLCEPVSQGGLGFDYYVNLSA
TEMWVSLLDTVPDSEWSMSKIVSTLVANKEYADKMLSYAESHNQSISGGRSFAEILFGGVQNEIKLLDRGVSLHKMIRLL
TFTIGGRAYLNFMGNEFGHPERVEFPTQSNKFSFSLANRRWDLLESGIHHQLFSFDKDLMDLDKSKGILSRGLPSIHHVN
DANMVISFSRGPFLFIFNFHPSNSYEKYGVGVEEAGEYTMILNSDEAKYGGQGLLKEDQYLQRSISKRIDGQRNCLEVFL
PSRTAQVYKLTRILRI*

DNA
ATGGTTTCCCTCTCTAACCAAACCTCGTTTTCTTTCTACCCAAACAACCTTTTCGTTTCCGACAAGACCCGCCTGGGCAT
CCCCGGAATCAACTTCCCCAGAAAAATCAAGGTGAAAGTCGCATGCTTCGCCGCCGACCAACCGCGCCAGCAAAAGCAAC
AGAAGAAGAAGAAGAGTCAGAGCACTAATAGCGATGCCGATTCCGGAGTCGACCCAGTTGGGTTTCTCACCAAACTCGGA
ATCGCCGACAGAATCTTCGCTCAGTTTCTCCGTGAAAGGCATAAAGCTATAAAAGACCTTAAAGATGAGCTTCTCAAACG
TCACTTCGATCTCAGAGATCTTGCTTCAGGGTTTGAGTTACTAGGGATGCATAGACACATGGAACACCGTGTTGATTTCA
TAGACTGGGGTCCAGGTGCTCGTTACGGTGCTATAATCGGAGACTTCAACGGATGGTCTCCAACAGAAAACTCTGCTAGA
GAAGGATTATTTGGCCATGATGACTTTGGCTATTGGTTCATTATTCTTGAAGATAAGTTAAGAGAAGGCGAAGAACCAGA
AGAACTATACTTCCAGCAGTACAACTACGTGGATGACTATGATAAAGGAGACAGCGGTGTAACAGCGGAAGAGGTTTTCC
AGAGAGCCAATGATGAGTATTGGGAGCCTGGCGAGGACCGGTTTATCAAGAACCGGTACGAAGTTCCTGCAAAACTATAC
GAGCAGCTGTTTGGTCCCAACAGTCCACAGACGTTAGAAGATCTAGGTGAGATACCAGACGCAGAGACGAGGTATAAGCA
GTACAAGGAGGAGCATAAGAATGATCCACCGAGTAATCTACCTCCATGCGACATCATTGATGACGGTCGAGGGAAACCAT
ATGATATCTATAACGTCGTGACATCTCCGGAATGGACAAAGAAGTTTTATGAGAAGTCACCTCCGATTCCGTATTGGTTA
GAGACGCGTAAAGGAAGGAAGGCGTGGTTGGAAAAGTACATTCCTGCTGTTCCACATGGAAGCAAGTATAGATTGTATTT
CAACACTCCTGATGGACCGCTTGAACGGGTGCCTGCTTGGGCTACATATGTGCAACCAGAGGACGAGGGGAAGCAAGCTT
ATGCAATTCACTGGGAACCTTCTCCTGAGTCTGCATACAAGTGGAAACACTCCAAGCCAGACAAACCAAAGTCATTGCGC
ATATACGAATGTCATGTTGGAATCAGTGGGTCTGAGGCAAAGATTTCATCTTTCGAGGAATTTACCAAGAAGGTCCTTCC
TCATGTGAAAAGAGCAGGATACAATGCAATCCAGTTGATTGGTATCCCTGAGCACAAGGATTATTACACTGTCGGTTATA
GGGTTACTAATTTCTTTGCTGTCAGTAGCCGATATGGAACGCCAGATGACTTCAAACGCTTAGTTGATGAAGCACATGGC
CTAGGACTCCTTGTCTTCTTAGACATTGTGCAGTCTTATGCAGCAGCTGATCAAATGGTTGGGCTTTCGCTTTTTGATGG
TTCAAACGATTGCTATTTTCATCATGGTAAAAGGGGGCATCACAAACACTGGGGCACACGGATGTTCAAATACGGCGACT
TGGATGTTTTTCATTTTCTCATTTCAAATCTGAACTGGTGGATTACAGAGTATCAAGTTGATGGTTACCAATTTCACTCG
CTTGCCTCGATGATCTACACGCACAATGGTTTTGCTCCTTTTAACAGCGGTTTTGATGACTATTGCAATCAGTATGTTGA
CCGAGATGCTCTGATGTACCTCATTTTGGCCAATGAAATCTTGCACGATTTGCATCCAGATATAATAACCATTGCTGAGG
ATGCAACATATTACCCTGGGTTGTGTGAGCCAGTTTCTCAAGGTGGGCTAGGATTTGATTATTATGTGAACCTTTCTGCG
ACAGAAATGTGGGTTTCTCTCCTTGACACCGTACCGGATAGCGAATGGAGCATGAGCAAGATTGTCAGTACATTGGTGGC
TAACAAAGAGTATGCAGACAAGATGCTCAGCTATGCCGAAAGTCACAACCAATCCATATCAGGAGGGCGTTCATTTGCTG
AAATCTTGTTTGGTGGAGTCCAAAATGAGATTAAGTTGCTAGACAGGGGCGTTTCATTACATAAGATGATTAGACTTCTT
ACGTTTACAATTGGTGGCCGTGCTTACCTCAACTTCATGGGAAATGAATTTGGACATCCTGAGAGGGTTGAGTTTCCTAC
ACAGAGCAATAAATTCTCGTTTTCGCTGGCTAACCGCCGCTGGGACCTGCTGGAAAGTGGAATCCATCATCAGCTGTTTT
CCTTTGACAAGGACCTAATGGACTTGGATAAAAGCAAGGGCATCCTTTCAAGAGGTCTTCCCAGCATCCACCATGTGAAT
GATGCAAATATGGTAATTTCATTCTCGAGGGGTCCTTTCTTGTTTATCTTTAACTTCCACCCATCGAATTCATATGAAAA
GTATGGTGTCGGCGTAGAGGAAGCTGGTGAATATACCATGATACTGAACTCTGATGAAGCGAAATATGGGGGTCAGGGAC
TTCTAAAGGAGGACCAGTATCTTCAACGGTCGATTAGCAAGAGGATTGATGGTCAAAGAAATTGCTTAGAGGTGTTTTTG
CCAAGCAGGACTGCACAAGTTTACAAGTTGACCCGGATTCTCCGAATATGA