Details for Chinese cabbage Locus Brara.E02130

Position : A05 ( 5`- 19519642 .. 19526746 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02130

Protein [Map View]
MSKITLGNESLVGSLTPSNKKSYKLTNKIQEGKTPLYSVAFNFIDARYFTCFVSAGGNGINLYNCLEDGSISLLYAFADE
DKEEEFNTASWACRVEGNPFVVAGGEKGIIRVIDVNNEKIHKSLVGHGDLVNEIRTQPLKPQLVLSASKDESVRLWNVET
GICILIFAGTGGHRNEVISVDFHPSDKHRFVSCGMDTTVKIWSMKEFWTYVEKSFTWKDDPSKFPTKFVELPVFTASVHT
DFVDCNRWVGDFILSKSDEILLWEPILKENSPGEGTSDVLLRYPIPNCNLWFIKFS

DNA
ATGTCGAAGATAACTTTAGGAAACGAATCACTTGTCGGCTCTTTGACTCCATCCAACAAGAAATCGTACAAACTGACCAA
TAAGATTCAAGAAGGGAAGACACCTTTGTACTCCGTTGCTTTCAACTTCATCGATGCTCGTTACTTCACTTGTTTCGTCT
CCGCTGGTGGCAATGGGATTAATCTGTACAATTGTCTTGAAGATGGAAGCATATCTTTATTGTACGCCTTCGCTGATGAA
GATAAGGAGGAGGAATTTAACACTGCAAGCTGGGCGTGTCGCGTTGAAGGGAACCCATTTGTTGTGGCTGGAGGAGAGAA
AGGCATAATCCGAGTCATTGACGTAAACAATGAAAAGATTCATAAGAGCCTTGTGGGCCACGGGGATTTAGTGAACGAAA
TCAGGACACAACCTCTGAAACCTCAACTTGTGCTTTCCGCTAGCAAGGATGAATCTGTTCGATTGTGGAATGTTGAAACT
GGGATTTGTATTCTGATATTTGCTGGAACTGGAGGTCATCGAAACGAAGTTATAAGTGTGGATTTTCATCCCTCTGATAA
GCACCGTTTTGTTAGTTGTGGTATGGACACCACAGTTAAGATATGGTCAATGAAAGAGTTTTGGACATACGTCGAGAAGT
CATTCACATGGAAGGATGATCCATCAAAGTTCCCAACAAAATTTGTAGAGCTCCCTGTATTTACAGCTTCGGTTCATACA
GATTTTGTTGATTGTAACCGTTGGGTTGGTGACTTTATTCTTTCAAAGAGTGATGAGATACTGCTGTGGGAACCAATACT
GAAAGAGAATTCTCCTGGAGAGGGTACTTCAGATGTTCTTCTTAGATACCCTATTCCAAATTGTAATCTCTGGTTTATCA
AGTTTTCT