Details for Chinese cabbage Locus Brara.E02125

Position : A05 ( 5`- 19469408 .. 19471653 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02125

Protein [Map View]
MSGAPTAASSGNHSLHLPTPTLDAESQSLLQSISAQGGYAYARMAALAVAGDQSAAEAARDMAWEQLHSGPWHSVLPVWR
DAYSMACLHVAKFHFAAGEFGEALGALDMGLIMGGTLLRKDLHDSVLLVSSEARKKAKSLGDFKGEKLVPEVPVDVNEVL
KILPLRSLTSGRVDKRSDLSMEGFLRDYFQTGTPVVITNCMAHWPARTKWNHLDYLTSVAGNRTVPVEVGKNYLCSDWKQ
ELVTFSKFLERMRTNRSTSVEPTYLAQHPLFDQINELRDDICIPDYCFVGGGELQSLNAWFGPAGTVTPLHHDPHHNILA
QVVGKKYIRLYPSSLQDELYPYSETMLCNSSQVDLDNIDKNEFPKAVELEFMDCILEEGEMLYIPPKWWHYVRSLTMSFS
VSFWWSNEAESSDS*

DNA
ATGTCAGGAGCTCCCACCGCCGCTTCCTCCGGAAACCACAGCCTGCACCTCCCGACTCCAACCCTCGACGCGGAGTCGCA
GTCCCTGCTGCAGTCGATCTCCGCTCAAGGCGGTTACGCCTATGCTCGCATGGCGGCGCTAGCAGTCGCCGGCGACCAAA
GCGCGGCGGAGGCGGCGCGTGATATGGCCTGGGAGCAGCTTCACTCCGGTCCCTGGCACTCTGTTCTCCCCGTGTGGCGC
GACGCTTACTCGATGGCGTGTCTCCACGTCGCCAAGTTCCATTTCGCCGCCGGCGAGTTTGGGGAAGCCCTCGGCGCGCT
CGATATGGGTCTCATCATGGGAGGGACGCTTCTCCGCAAGGACCTCCACGACTCTGTGCTCTTGGTCTCCTCTGAAGCTC
GTAAGAAGGCTAAGAGCCTCGGAGATTTCAAGGGTGAGAAACTTGTCCCTGAAGTTCCCGTCGACGTCAATGAGGTGCTA
AAGATTCTACCTTTGAGGTCATTGACTAGTGGAAGAGTAGACAAGAGGTCTGACTTATCTATGGAGGGGTTTCTGCGTGA
TTATTTTCAGACAGGTACACCTGTTGTTATAACCAATTGTATGGCTCATTGGCCTGCTAGGACCAAGTGGAACCACTTGG
ACTATCTCACTTCTGTTGCTGGTAACCGTACCGTTCCCGTCGAGGTGGGGAAAAACTATTTGTGTTCAGATTGGAAGCAA
GAGCTTGTGACGTTTTCCAAGTTCCTTGAACGGATGAGGACCAATAGATCCACCTCCGTGGAACCTACTTATCTTGCTCA
GCATCCGTTGTTTGATCAGATAAATGAACTGAGGGATGATATATGTATTCCTGATTACTGTTTTGTCGGTGGAGGGGAAC
TCCAATCTCTTAATGCGTGGTTTGGTCCGGCTGGGACAGTTACTCCCTTACACCATGATCCACATCATAATATACTTGCT
CAGGTTGTTGGCAAGAAGTATATAAGGCTTTACCCATCCTCATTGCAAGACGAACTTTACCCTTATTCTGAGACAATGCT
TTGCAACTCTAGCCAGGTTGATCTTGACAACATCGACAAGAACGAGTTTCCAAAGGCGGTGGAGCTAGAGTTTATGGATT
GTATCCTAGAGGAAGGAGAAATGCTATACATCCCTCCCAAATGGTGGCACTATGTCAGGTCCTTAACAATGAGTTTCTCG
GTTAGCTTCTGGTGGAGCAATGAAGCAGAGTCCTCTGATTCTTAG