Details for Chinese cabbage Locus Brara.E02119

Position : A05 ( 5`- 19380124 .. 19382783 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02119

Protein [Map View]
MNSNNWLGFPLSPNHSSLPPHEYNIGLVSDHMDNPFQTQEWNMINPHGGGGEVPKVADFLGVSKPDENQSDHIVAYNDSG
YYFHTTNSLMPSVQSNDVVVACDSNNPNDSYELQESAHNLQSLTLSMGTTGGNNAVAKALPPEVTGDNTSGGALAVAETA
TPRRALDTFGQRTSIYRGVTRHRWTGRYEAHLWDNTCRREGQSRKGRQEAQALESSRKREAEMIALGSSFQYGSGSSSSR
LQLQPYPLSIQQPLEPFLSLQNNDISHYNTNSHDTSSFNHNSYIQTQLHLHQQTNNYLQQQSGQNSQQLYNAYLQSNPDL
LHGLVSTSIVDNNNNGGSSGSYNTAAFLGNHGIGIGTSSTVGSTGEFPAVKTDYDMASSDGNGGYGGWTGESVQGSNPGG
VFTMWNE*

DNA
ATGAATTCAAACAACTGGCTTGGCTTTCCACTTTCACCAAACCACTCTTCTTTGCCTCCTCATGAATATAACATTGGCTT
GGTGAGCGACCATATGGACAACCCTTTCCAAACACAAGAGTGGAACATGATCAATCCACACGGTGGAGGAGGAGAGGTTC
CAAAAGTGGCAGACTTTCTCGGTGTGAGCAAACCGGACGAAAATCAATCCGACCACATCGTAGCTTACAACGACTCAGGT
TACTACTTCCATACCACCAATAGCTTGATGCCAAGCGTCCAATCAAACGACGTCGTTGTAGCTTGTGACTCCAACAATCC
TAACGATAGCTATGAGCTCCAAGAGAGTGCTCACAATCTACAGTCACTCACTTTGTCCATGGGGACGACCGGTGGTAATA
ACGCTGTAGCTAAAGCGTTGCCGCCCGAGGTCACCGGCGATAACACTAGCGGTGGAGCATTAGCCGTTGCTGAGACGGCC
ACGCCAAGACGTGCTTTGGACACTTTCGGACAACGCACCTCGATCTATCGTGGTGTCACAAGGCATCGATGGACCGGTCG
ATATGAAGCTCACCTGTGGGATAATACTTGTAGAAGGGAAGGTCAGTCTAGGAAAGGAAGACAAGAAGCTCAGGCTCTTG
AGTCTTCAAGGAAACGCGAGGCTGAGATGATAGCCCTTGGTTCAAGTTTCCAATATGGTAGCGGCTCGAGCTCATCAAGG
CTTCAGCTTCAACCTTACCCTCTAAGCATTCAACAACCATTAGAGCCTTTTCTTTCTCTACAGAACAATGATATCTCTCA
CTACAATACCAATTCTCATGACACGTCTTCCTTTAACCACAATAGCTATATCCAAACGCAGCTTCATCTTCACCAACAAA
CCAACAATTACTTGCAGCAACAATCGGGTCAGAACTCGCAGCAGCTCTATAATGCCTATCTTCAAAGCAATCCGGATCTG
CTTCATGGCCTTGTCTCCACCTCTATCGTTGACAACAACAACAATGGAGGCTCTAGTGGGAGCTACAACACTGCAGCTTT
TCTTGGGAACCACGGCATTGGTATTGGGACGAGCTCGACCGTTGGATCGACCGGGGAGTTTCCAGCTGTTAAAACAGATT
ACGATATGGCTTCGAGTGATGGCAATGGAGGGTATGGTGGTTGGACCGGTGAGTCTGTTCAGGGGTCGAATCCTGGTGGT
GTTTTCACTATGTGGAATGAGTGA