Details for Chinese cabbage Locus Brara.E02107

Position : A05 ( 5`- 19307077 .. 19307623 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02107

Protein [Map View]
MASMTMTATFLPAVAKLPSTTGGRRLSVIRASQSENTTTLQVKEAQNSSTMRRDLMFTAAAAAVCSLAKVAMADEEEPKR
GTDAAKKKYAQVCVTMPTAKICRY*

DNA
ATGGCATCGATGACCATGACAGCCACATTCCTCCCGGCCGTTGCAAAGCTCCCGTCAACCACCGGCGGACGAAGGCTCTC
AGTGATCAGAGCTTCACAGAGCGAGAACACAACTACCTTACAAGTCAAGGAGGCGCAGAACAGCAGCACAATGAGGAGGG
ATCTCATGTTCACAGCTGCAGCTGCGGCCGTTTGTTCCTTGGCTAAGGTAGCCATGGCAGACGAGGAGGAGCCCAAACGA
GGGACAGATGCAGCTAAGAAGAAGTACGCTCAAGTTTGTGTCACAATGCCGACAGCCAAGATCTGTCGCTACTGA