Details for Chinese cabbage Locus Brara.E02103

Position : A05 ( 5`- 19252792 .. 19255928 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02103

Protein [Map View]
MDPGDPTSILFTKIRTLEPDLASKIIGYLLLQDLGKRDLMRLALGPDTLLQSVCLKAKSALGLSNGSSSSSSGTTPPLLN
PISRPINIHRHSPFMEFSRSPSLNNTPGSSNPNVGSSPFQASSSLFASDGDDLVDEGQLGNYLSFLNDSSSKNNNNDETT
DLFGFSGDNDDAHLHKRSFSASDVSEEPGYGGYCRFPGLGDDFESPGGGFGSPDFRQQEEIARMKLAQRQRMAAAQFLAA
SGGSPMSYDKGINFLLGSRNAHHRSGGAGQFGDEGYWFGSPGRHERDEFLGMGDKSNSASKQIYLTFPADSSFTDEDVSN
YFGNFGPVQDVRIPYQQKRMFGFVTFVHSETVRIILARGNPHFICDSRVLVKPYKEKGRILENRRQQQQLMQQMERGNFS
PGSSPSGMDARDLFDCHFGPRMFSSTQEMMRRKAEQAELQQALEFQRRRLVNLQLPDLDSESFHHHQRSLSIGSPVHYPS
RVNQSMLFRSENAGEEGNGDSGHFHSDSENKNSQEGGYVNHFNTGQETSLESALPDCFFASPSKTGETQEQSESENENCA
TVESKPASTLQSA*

DNA
ATGGATCCTGGAGATCCCACTTCCATACTCTTCACAAAGATCCGAACTTTAGAACCGGACTTGGCCTCCAAAATCATAGG
CTACTTGCTCTTACAGGACTTGGGCAAGAGAGACTTGATGCGTCTCGCTCTTGGACCCGACACTCTCTTGCAGTCCGTTT
GTCTCAAGGCTAAATCCGCTTTGGGTCTCTCGAACGGATCTTCTTCTTCTTCTTCTGGCACGACGCCGCCGTTGTTGAAC
CCTATCTCGAGACCCATTAACATCCACCGCCATTCTCCGTTTATGGAGTTCTCGAGGAGCCCTTCCTTGAACAACACTCC
TGGGAGTAGCAACCCTAACGTGGGTTCGAGTCCGTTTCAAGCAAGTTCCTCTCTTTTCGCTTCAGATGGTGACGATTTAG
TCGATGAGGGGCAACTCGGTAACTACTTGTCCTTCCTCAACGACTCTTCTTCTAAGAACAACAACAACGACGAAACCACG
GATCTGTTCGGGTTCTCCGGTGATAATGACGATGCCCATTTGCACAAGAGGAGTTTCTCTGCGAGCGATGTTTCAGAGGA
ACCCGGTTATGGCGGTTACTGTCGGTTTCCTGGTTTAGGAGATGATTTTGAGTCTCCAGGTGGTGGGTTTGGTTCTCCGG
ATTTCAGACAGCAAGAGGAGATAGCGAGGATGAAACTGGCTCAACGGCAGCGAATGGCCGCGGCGCAGTTCTTGGCGGCT
AGTGGTGGCTCTCCAATGTCGTATGATAAAGGCATTAATTTTCTCTTGGGTTCGCGTAACGCTCATCATAGATCAGGAGG
AGCAGGACAGTTTGGGGATGAGGGTTACTGGTTTGGTAGTCCAGGGCGACATGAAAGAGATGAGTTTTTGGGGATGGGAG
ATAAATCAAACTCTGCATCTAAGCAGATTTACTTGACTTTTCCAGCTGACAGCTCCTTCACAGATGAAGATGTCTCCAAC
TACTTTGGCAATTTTGGACCAGTGCAGGATGTTAGGATTCCATACCAGCAGAAACGGATGTTTGGGTTCGTCACTTTTGT
ACACTCTGAGACTGTGAGAATCATATTGGCCAGAGGAAACCCACATTTCATCTGCGACTCACGCGTGCTTGTTAAACCCT
ACAAAGAGAAAGGAAGAATCCTTGAAAATAGGAGGCAGCAGCAACAACTGATGCAGCAGATGGAGAGAGGGAACTTTTCT
CCGGGTTCAAGTCCATCTGGAATGGACGCAAGGGATCTCTTTGATTGCCACTTCGGACCGAGGATGTTTTCTAGCACACA
AGAAATGATGAGGAGAAAAGCTGAGCAAGCTGAGTTACAACAAGCATTAGAATTCCAGAGGAGAAGACTTGTCAATCTGC
AGTTGCCCGATTTGGATAGCGAGTCGTTTCACCATCACCAGCGCAGTCTTTCTATTGGCTCCCCTGTTCATTACCCCTCC
CGCGTCAATCAAAGCATGCTCTTTCGATCTGAAAACGCCGGTGAAGAAGGTAATGGTGATTCAGGACATTTTCATTCTGA
TTCTGAAAATAAAAACAGCCAAGAAGGTGGTTATGTTAACCATTTCAACACAGGGCAAGAGACAAGTCTGGAGAGCGCTC
TGCCTGATTGCTTCTTTGCTTCCCCATCAAAGACCGGTGAAACCCAAGAACAGTCCGAGTCTGAGAATGAGAACTGTGCT
ACTGTGGAAAGTAAGCCAGCCTCAACACTTCAATCAGCTTAG