Details for Chinese cabbage Locus Brara.E02101

Position : A05 ( 5`- 19242941 .. 19243918 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02101

Protein [Map View]
MLIDGRVYFARLDLHGITDDNVVKVKSQFSLNDYPLSIRDIFHCDGLLLCTTMDERLVVWNPCSGETSRIIKPLNSKYSF
DVYALGKSSCNNEYKILRVHHHGDGWMSPCLVKYEIYDFTSNSWRVVGEIRGWTFPGPWRHGTSVDGNTYWLSFDFSQDR
QRPKNTLRYFDYSTERFGLVSLPGDPLSYHPFALSVTGEEQNLCLLTSCVKLLDIGVWMAIKIKGTGDMSWSKLLTVKRT
SSDQFFKLCKGVSFLADRKNKVIVHPIKDVNFRNFLHIVGEDKYRKVNLCAVGYALPVSCDPTLVQIQQGSLGLGTWKEP
ITKFS*

DNA
ATGTTAATTGATGGTAGGGTCTATTTTGCTAGGCTTGATCTCCATGGCATTACCGACGACAACGTTGTAAAGGTAAAAAG
TCAGTTCAGCCTCAATGATTATCCTCTTTCTATACGTGATATCTTTCACTGCGACGGCCTATTGCTATGCACCACCATGG
ACGAAAGACTGGTTGTCTGGAACCCATGTTCAGGGGAAACAAGTAGAATTATCAAACCCTTAAATTCCAAATATAGTTTT
GATGTCTACGCGCTCGGTAAATCCTCATGCAACAACGAGTATAAAATCTTGAGGGTCCATCATCATGGAGATGGTTGGAT
GTCTCCATGCCTTGTTAAGTACGAAATATATGACTTTACATCTAATTCCTGGAGGGTTGTTGGTGAGATTAGAGGGTGGA
CATTTCCAGGGCCCTGGCGACATGGCACGTCTGTGGATGGAAATACTTACTGGCTTTCTTTTGATTTTAGTCAAGACCGT
CAAAGACCGAAAAATACCTTACGATATTTTGATTATTCAACAGAGAGGTTTGGACTTGTGTCTCTTCCGGGTGATCCTCT
ATCTTATCATCCTTTTGCCTTATCAGTGACTGGAGAAGAGCAAAATCTTTGTCTGTTAACTTCTTGTGTCAAACTACTCG
ATATAGGTGTATGGATGGCAATTAAAATTAAAGGTACAGGAGACATGTCATGGAGTAAACTCTTAACAGTGAAACGAACC
AGTAGCGACCAGTTCTTTAAGCTTTGTAAAGGTGTGAGTTTCTTGGCCGACCGGAAGAATAAAGTTATAGTGCATCCCAT
TAAAGATGTGAACTTTAGGAACTTCTTACACATTGTGGGAGAGGATAAATACAGAAAAGTGAACCTTTGTGCTGTAGGAT
ACGCACTTCCTGTCAGCTGTGATCCAACTTTGGTTCAAATCCAACAAGGTTCTTTGGGGCTAGGCACATGGAAAGAACCA
ATCACCAAGTTTTCATGA