Details for Chinese cabbage Locus Brara.E02097

Position : A05 ( 5`- 19220530 .. 19224535 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02097

Protein [Map View]
MARSKAVVSGSHAHGIWKYFNPAYYLRRPRRLALLFFLFLSVSMVLWDRHSLSRDYQLEVSKLNEEVMRLQLLLEDVKSV
VAEDVSVNSSTLKDDVQEDPLDAQRMLRVKEAMIHAWSSYEKYAWGQDELQPQTKDGVDSFGGLGATMIDALDTLYIMGL
DEQFQKAREWVATSLDFDKDYDASMFETTIRVVGGLLSAYDLSEDKLFLDKAKDIADRLLPAWDTPSGIPYNIINLRHGN
AHNPTWAGGDSILADSGTEQLEFIALSQRTGDPKYQQKVEKVISVLNKDFPADGLLPIYISAETANPSHSTITFGAMGDS
FYEYLLKVWVFGSKTSSVKHYRDMWEKSMNGLVSLVKKSTPSSFTYICEKSGTSLSDKMDELACFAPGMLALGASGYNDP
AEAKKFLTLAEELAWTCYNFYESTPTKLAGENYFFNSGSDMSVGTSWNILRPETVESLFYLWRLTGNKTYQDWGWNIFEA
FEKNSRIESGYVGLKDVNTGVKDNKMQSFFLAETLKYLYLLFSPTTVIPLDEWVFNTEAHPLKIVPWNDQVSLGQSTAVQ
QRKPTIRLRQRRIGRMTNK*

DNA
ATGGCGAGGAGTAAGGCGGTGGTGAGTGGTAGTCATGCTCATGGGATATGGAAATACTTCAACCCAGCTTATTATCTCAG
AAGGCCTAGGCGTCTTGCTCTTCTCTTCTTCCTCTTCCTCTCCGTTTCCATGGTCCTTTGGGATCGTCATTCTCTCTCCC
GTGATTACCAGCTTGAAGTTTCCAAGTTAAATGAAGAAGTTATGCGGTTGCAGCTGTTGTTAGAAGATGTAAAAAGCGTC
GTCGCGGAGGATGTATCTGTGAATAGTAGTACATTGAAGGATGATGTTCAGGAAGATCCGCTTGATGCCCAGAGAATGCT
GAGAGTAAAAGAAGCAATGATTCATGCTTGGAGCTCATACGAAAAGTATGCCTGGGGACAAGATGAGCTTCAGCCCCAGA
CAAAAGATGGGGTTGACAGCTTTGGTGGCCTGGGAGCAACTATGATAGATGCATTAGATACACTCTACATAATGGGTCTA
GATGAGCAGTTTCAGAAAGCCAGGGAGTGGGTTGCAACCTCATTAGATTTCGACAAGGATTATGACGCCAGTATGTTCGA
AACAACTATAAGAGTGGTGGGAGGGCTTCTCAGCGCGTATGATCTTTCTGAGGATAAACTTTTCCTTGATAAGGCTAAGG
ATATAGCAGACAGATTATTGCCAGCATGGGACACTCCATCGGGTATACCATACAATATTATCAACTTGAGACATGGAAAT
GCTCACAATCCTACATGGGCAGGGGGAGACAGTATTCTTGCAGATTCTGGTACTGAACAGCTCGAGTTTATTGCCCTTTC
CCAGAGGACAGGGGACCCAAAATATCAACAAAAGGTAGAAAAGGTTATTTCAGTACTAAACAAGGACTTCCCTGCGGATG
GTCTACTTCCGATTTATATAAGTGCCGAGACAGCTAATCCATCGCACTCTACCATTACATTTGGTGCCATGGGAGACAGC
TTTTACGAATATTTGCTCAAAGTTTGGGTGTTTGGGAGCAAAACTTCATCAGTGAAACACTATAGAGATATGTGGGAGAA
ATCAATGAATGGTCTGGTAAGCTTGGTTAAGAAATCAACACCTTCGTCGTTTACATATATCTGTGAGAAGAGTGGAACCT
CTTTGTCCGACAAGATGGATGAGTTGGCATGCTTTGCTCCTGGAATGTTGGCTTTAGGAGCATCTGGGTATAATGATCCC
GCTGAAGCAAAGAAGTTTCTCACCCTTGCTGAAGAGCTTGCATGGACATGTTATAACTTTTACGAATCAACACCAACAAA
ACTGGCCGGGGAGAATTATTTCTTCAACTCTGGGAGTGACATGAGTGTTGGAACATCGTGGAACATTTTGAGACCAGAAA
CTGTCGAATCACTGTTTTACCTGTGGAGGTTGACCGGTAACAAGACATATCAAGACTGGGGATGGAATATATTTGAAGCG
TTTGAGAAGAACTCTCGCATAGAGTCTGGATATGTCGGTTTAAAGGATGTTAATACAGGAGTTAAGGACAACAAGATGCA
AAGTTTCTTCCTTGCTGAGACGCTCAAGTATCTCTATCTCCTCTTCTCCCCCACAACGGTGATTCCCTTGGACGAGTGGG
TATTCAACACAGAAGCTCATCCACTTAAGATTGTGCCCTGGAATGATCAGGTGAGTCTCGGACAATCCACGGCCGTGCAG
CAACGCAAACCAACAATTAGATTACGCCAGAGGCGGATTGGTCGGATGACAAACAAGTAA