Details for Chinese cabbage Locus Brara.E02094

Position : A05 ( 5`- 19194571 .. 19201684 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02094

Protein [Map View]
MGVDLRQVVAGILTITMFVMLGQMLHRDYFDSLQEKAQGDAHDIEFEGSRVSVKDSLVGAVEGSKGPWMDDTNDLNPCWP
TLLSDEAVSSKGYVTFSLTNGPEYHISQITDAVMVAKHLGATLVLPDIRGSKPGDERNFEDIYDADKLIKSLKNVIKVVK
QLPEEVSLRDIAIVKVPTRVTEDYIKENIDPIFKSKGNIRVATYFPSVNLRKSSQDGETDPVACLAMFGSLELQPELNAV
VESMIERLRTHSRKSAGRFIAVDLRIDILEKKHCHSTGVVGSKTCYNAQEIAVFLRKLGFAGDTTIYLTQPRWDSSLNIL
KDIFPKTFTKEAIMPASKKSKYLESESSEYENVIDFYISSRSDVFVPAISGLFYANIVGKRIALGKPQVLVPAEISETSG
LATDFISPYISKKNHLAYSCFC*

DNA
ATGGGTGTGGATTTGAGGCAAGTGGTTGCTGGTATCCTCACCATTACCATGTTCGTGATGCTCGGACAGATGCTTCATAG
AGATTACTTTGATTCTCTTCAGGAGAAAGCTCAGGGAGATGCACACGATATTGAATTTGAAGGATCTAGAGTATCTGTGA
AAGATAGTCTTGTCGGAGCCGTAGAAGGCAGTAAAGGGCCTTGGATGGATGATACCAATGACCTTAACCCTTGTTGGCCA
ACTTTACTATCCGATGAAGCGGTATCATCAAAAGGGTATGTTACATTCTCACTAACGAACGGTCCTGAGTATCATATCTC
TCAGATCACTGATGCTGTAATGGTGGCAAAGCATCTTGGAGCAACATTAGTGCTTCCTGATATAAGAGGAAGCAAACCTG
GTGATGAAAGGAACTTTGAAGACATTTATGATGCTGATAAACTGATCAAAAGCTTGAAAAACGTCATCAAAGTTGTCAAA
CAATTGCCTGAAGAAGTATCTCTAAGGGACATCGCCATTGTAAAAGTCCCTACCAGAGTTACAGAGGACTACATTAAGGA
GAACATTGACCCAATCTTCAAATCAAAAGGAAACATCCGAGTTGCTACGTACTTCCCTTCTGTAAACTTGAGAAAATCCT
CGCAAGACGGCGAAACCGATCCTGTGGCTTGTTTGGCAATGTTTGGTTCCTTGGAGTTGCAACCTGAGCTGAATGCAGTA
GTTGAATCAATGATTGAGAGGTTAAGGACTCATAGCAGGAAATCAGCTGGCCGTTTCATAGCTGTAGACCTTAGAATCGA
CATACTTGAGAAGAAACATTGCCACTCAACTGGTGTAGTTGGGTCCAAGACATGTTACAACGCGCAAGAGATTGCTGTAT
TCTTGAGGAAGCTTGGATTTGCTGGTGACACAACTATCTATCTCACTCAGCCAAGGTGGGACAGTAGCCTCAATATCCTT
AAGGATATCTTCCCAAAAACGTTCACAAAGGAGGCAATAATGCCAGCAAGCAAGAAATCAAAGTACCTTGAATCAGAGAG
TTCAGAGTATGAAAATGTTATTGACTTCTACATAAGCTCGAGAAGCGATGTGTTTGTTCCAGCCATATCTGGTTTGTTTT
ATGCAAACATAGTTGGGAAGAGGATAGCTTTAGGTAAGCCACAAGTGCTAGTTCCAGCAGAGATCTCAGAGACATCTGGC
CTTGCTACAGATTTCATCTCTCCTTACATCTCAAAGAAGAACCACTTGGCTTATTCATGTTTTTGCTGA