Details for Chinese cabbage Locus Brara.E02082

Position : A05 ( 5`- 19043740 .. 19050063 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02082

Protein [Map View]
MSYGGSSKPGRGRGGGIGGGGGGGPGRNRNSFPPLTNRHPSPIGRMSTGGGGSSAAPRQRNTTSVKAAAAASSSRTVEEK
FSLVPRESPPAFGMIIRLTPDLVDEIKRVEAEGGAAKIKFDAFPNNSTGNIIDVGGKEFKFTWSGERGDLCDIYEEHQSG
EDENGVLIEAGSAWRKLNVQRTLDESTTSQMKMRSVEAEQRTKSRKAIVLDPGNPSLKKQLARAEASPWRMSNNQKKEPP
PKKRKVDPPPVPIGGPKPSFRPGVSTTSVKNRLSASPGPSPSNQYNTPSSYGTGNIAKTHADNVNVTPVNTKARESIVAS
EKDLSTWERNALRDTSERQETNVNKEIDLQALLVDLLKEAPMSLKALEKAVGDRTPNASKKIEPILKKIANFQAPRYFLK
PEADLDSRSSPEHQQLLPITECNRDQLPVPGVSNMETFSVCERKGEGLQEFSPLPREHLSTQENVDIEHHSPGILHEEKR
SENRNGQARSSSSDSDSDNSGSSSDSGSSSDSEASSNSKEVSDEDVDIMSDGDKEPRQTIDIEGNDSDAVDIDGHDSDAV
DIDGHSSDEGHGSEADRKNEVGISELEQLPSGHDKLRERQNFIGQLFDDTDNTTKDSLKSDHPGISERLATDQNQISPAL
EHYSQQSARERNIKSQQLPAIGKDSQLSERKNDLQHLNASASQMMDPLKRIQKSSTEKLSRHGQMKPGDSSGKSNKHSDA
LGDVRKSDEDDHFPHETLSSRSGKAFRDNHRDAVHSKNKFARNKKDGESSIGPSFPSDRANRKYGELDGSEKDPKNVSGL
GMGSSPLDSQRAKLPKGNGSMLQKQVSDLELGELPESLEVDTALKQLEDKTSFRQSNLKPSTSENLGIDSDKRRSKKSSK
KPALTHAGNGTKELPQHVVDDSERSQKLALQSHEQNHTGADTENGSHNNNLEDAAYKSRQRDSRGRVGSSVEGYGETNKK
TPVIKQGSKRPSTSRSSRESKRHKNATSMNGHKDATFDEEDSSYLKYEKASPDQKGPIRDHLQYKAYMQEYLDKYDDYCS
INKILESYRNDFQKLGEDLKLAKGRDMVRYNKIVEDLNESYRKYGERHKRLKKVFIVLHEELKQLKERMKDYASSHGKD*

DNA
ATGAGTTACGGAGGATCGTCGAAACCCGGTCGCGGTAGGGGTGGAGGAATAGGAGGCGGCGGCGGTGGTGGACCGGGCCG
AAACCGCAATTCGTTCCCGCCTCTCACCAACCGACATCCTTCCCCCATCGGGAGGATGTCCACCGGTGGTGGTGGCTCCT
CCGCCGCCCCACGGCAGAGGAATACTACCAGCGTCAAGGCGGCGGCGGCGGCGTCTTCATCTCGTACGGTTGAGGAAAAG
TTTAGCCTAGTTCCGAGGGAGAGTCCACCGGCTTTTGGGATGATAATACGGTTAACTCCTGACTTGGTGGATGAGATCAA
GCGCGTGGAGGCAGAAGGTGGAGCCGCCAAGATCAAGTTCGATGCCTTTCCGAATAATAGCACTGGGAATATAATCGATG
TTGGTGGAAAGGAGTTCAAATTTACCTGGTCAGGGGAGCGTGGTGATTTATGTGATATCTATGAGGAACACCAAAGTGGT
GAAGATGAAAATGGTGTGCTGATTGAGGCTGGATCTGCTTGGAGAAAATTGAACGTCCAGCGAACTCTAGATGAGTCAAC
CACAAGCCAGATGAAGATGCGCTCAGTCGAAGCTGAACAGAGGACCAAATCGCGCAAGGCAATTGTTTTAGATCCTGGGA
ATCCATCATTGAAGAAGCAATTAGCTCGTGCTGAAGCAAGTCCATGGAGAATGTCAAATAACCAGAAGAAGGAACCTCCG
CCTAAGAAGCGGAAAGTCGATCCACCTCCAGTTCCAATCGGAGGTCCAAAGCCTTCTTTCAGACCAGGGGTTTCAACCAC
TTCTGTGAAGAATAGGCTTTCAGCTTCACCTGGACCATCTCCTTCTAATCAATACAATACCCCTTCTTCATATGGGACTG
GGAATATTGCTAAAACTCATGCAGATAACGTGAACGTCACACCAGTCAACACAAAGGCCAGAGAGAGCATTGTTGCTAGC
GAAAAGGATTTATCAACCTGGGAAAGAAATGCTTTAAGGGACACATCTGAACGCCAAGAAACCAATGTTAATAAAGAAAT
TGACTTGCAGGCACTGCTAGTTGATCTCCTAAAAGAGGCTCCAATGAGCTTGAAGGCTTTAGAGAAAGCTGTTGGAGATA
GAACCCCTAATGCGTCAAAGAAGATTGAGCCAATTTTGAAAAAAATTGCAAATTTCCAAGCTCCAAGGTATTTCTTAAAA
CCAGAAGCAGATTTGGATAGCAGAAGTTCACCTGAACACCAGCAACTGCTTCCAATCACTGAGTGCAATCGCGACCAGTT
ACCTGTTCCAGGGGTTAGCAACATGGAGACCTTTTCTGTGTGCGAGCGGAAAGGAGAAGGTTTACAAGAGTTTTCACCTT
TGCCTCGAGAGCATCTGAGTACACAAGAAAATGTTGACATTGAGCATCATTCACCTGGCATTCTTCATGAGGAAAAGCGA
TCTGAGAACAGAAATGGCCAGGCTCGTAGCTCTAGTAGCGACAGTGATAGTGATAATAGTGGGAGCAGCAGTGATAGCGG
GAGCAGCAGTGATAGCGAGGCTTCTTCTAACAGCAAGGAAGTTTCTGATGAGGATGTGGATATAATGAGCGATGGTGACA
AAGAGCCCCGACAGACAATTGACATCGAGGGTAATGATTCTGATGCTGTCGACATCGATGGTCATGATTCTGATGCGGTG
GACATCGATGGTCACAGTTCAGATGAGGGTCATGGTTCTGAAGCTGACAGGAAGAATGAAGTTGGCATTTCAGAGCTGGA
ACAACTACCTTCTGGTCACGACAAGCTACGAGAGCGCCAAAATTTTATTGGACAGTTGTTTGATGACACAGATAATACTA
CGAAGGATAGTTTAAAAAGTGACCATCCTGGCATCTCTGAGAGGCTGGCCACAGACCAGAACCAAATATCCCCTGCTTTG
GAGCACTACAGTCAGCAATCAGCACGGGAGAGAAACATAAAATCCCAGCAATTGCCTGCCATAGGTAAAGATTCACAGCT
TTCAGAGCGCAAGAATGATTTACAACATCTGAACGCTTCTGCTAGTCAAATGATGGATCCACTAAAACGAATTCAGAAGT
CATCTACTGAAAAGTTGAGTAGACATGGTCAAATGAAGCCTGGTGATAGTTCAGGTAAATCAAACAAACATTCTGATGCC
TTGGGTGATGTTCGTAAATCTGACGAAGATGACCATTTTCCGCATGAAACCCTTTCTAGTCGGTCAGGAAAGGCCTTCAG
AGACAATCATAGGGATGCTGTTCATTCAAAAAATAAGTTTGCGAGGAACAAAAAAGATGGTGAGTCATCCATTGGACCTT
CATTTCCTTCTGACAGAGCCAACAGAAAATACGGTGAACTGGATGGAAGTGAGAAAGATCCCAAGAATGTTTCAGGCTTG
GGCATGGGTTCCTCTCCATTGGATAGCCAGAGAGCAAAATTACCCAAGGGAAATGGATCTATGCTCCAAAAACAAGTTTC
CGACTTGGAGTTGGGTGAACTCCCTGAGTCATTGGAGGTAGATACAGCACTGAAGCAACTCGAAGATAAAACTTCTTTTA
GGCAGTCAAATTTGAAACCAAGCACTTCAGAAAACTTGGGTATTGACTCAGATAAACGGAGGTCTAAAAAATCTTCGAAA
AAGCCAGCTCTCACACATGCTGGCAATGGTACAAAAGAATTGCCCCAACATGTTGTTGATGATTCAGAAAGATCCCAAAA
GTTGGCTTTGCAGTCACATGAGCAGAACCATACAGGTGCAGACACTGAAAACGGCTCACATAACAATAATTTAGAGGATG
CAGCTTATAAATCAAGACAGAGAGATAGTAGAGGAAGAGTAGGAAGCAGTGTGGAAGGTTATGGAGAGACGAACAAAAAA
ACGCCCGTTATAAAGCAGGGCTCCAAACGACCATCCACATCCCGCTCATCAAGGGAGAGCAAAAGACACAAAAATGCAAC
TTCTATGAATGGACACAAAGATGCAACTTTTGATGAAGAAGACTCTTCTTATTTGAAATACGAGAAAGCCTCTCCCGACC
AAAAGGGACCTATTAGGGATCATTTGCAGTATAAAGCATACATGCAGGAATATTTGGATAAATACGATGATTACTGCTCC
ATTAACAAGATATTAGAGAGCTACAGGAATGACTTTCAAAAGTTGGGGGAAGACCTTAAGCTTGCAAAAGGAAGAGACAT
GGTGAGATATAACAAAATTGTGGAGGACTTGAACGAATCTTATCGCAAATATGGAGAGAGGCACAAACGTTTGAAGAAAG
TGTTTATTGTTCTCCATGAAGAATTGAAGCAACTGAAAGAAAGAATGAAAGACTATGCATCATCTCACGGGAAAGATTGA