Details for Chinese cabbage Locus Brara.E02080

Position : A05 ( 5`- 19035153 .. 19038195 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02080

Protein [Map View]
MGSSDERNSKAIDASVGGLVWVRRRNGSWWPGRIMAHHEVPDDTIVSPKSGTPIKLLGRDDAGVDWYNLEKSKRVKAFRC
GEYDACIETAKATATGASKKPVKYARREDAIVHALEIESALLVGKDEKPSTSSDSTDVAKTEGALQSSVSCEKTSNGESS
KVQPLSGKRRKRTPNDSEVDGSDEGNKRMRGLEDLGVGTIGSNGEANKQENGLVSDEEDISDSMPNGVLANGTSRGSSPA
MKGKRSPAVTAMASVAVSENKDSAVVNNDNLDSNGVSCENDDVSLNASENVAEVMIHNNAKETEISSISVSAKDEVFDVP
LLGEDKYSAGAFTSSHTKALALVSEPTRQCDDVVKTEGCNGFVCVSPSALLINGIEDITSKWQIKGKRNPRQMSKKQEER
RLAYAEEASNNSLPHCSLSDQYPHGHFSGMGRNSQLYDVKIEGKGSYKPRNVPMISLMSKLDGEAIVGHPLTVEVLQDGS
CDRILCSHIKSLVVPMVAGDVKPKPSWKNKSKKKKPHIPPHKSSKSKKASSLSVKTRCLSALSGQKLTVSSKKKVMIEKT
REGIVSCIPLKVVFSRINEAVKGSARQVHRALPSSGNNTT*

DNA
ATGGGGAGTAGCGATGAGCGAAACAGTAAGGCGATTGATGCCTCCGTTGGAGGTTTGGTTTGGGTCCGACGCCGTAACGG
GTCTTGGTGGCCGGGTCGGATCATGGCTCATCACGAGGTTCCTGATGATACCATCGTTTCTCCCAAATCAGGCACACCTA
TTAAGCTTCTAGGTCGTGACGATGCTGGCGTGGATTGGTATAATCTTGAAAAGTCCAAGAGGGTGAAGGCGTTTCGTTGT
GGGGAGTATGATGCTTGTATTGAGACTGCTAAGGCTACTGCCACTGGTGCTAGTAAGAAGCCTGTCAAGTACGCTCGACG
TGAAGACGCCATTGTCCATGCTCTCGAGATCGAGAGTGCCCTCCTTGTTGGAAAAGATGAGAAGCCAAGCACGTCTTCTG
ACTCGACTGATGTGGCAAAGACTGAAGGTGCCTTGCAGTCTAGTGTGTCTTGCGAAAAGACTAGTAATGGCGAGTCTTCA
AAGGTGCAGCCTTTGTCAGGAAAGAGGAGGAAAAGAACACCTAATGACTCGGAAGTTGATGGGAGTGATGAAGGGAACAA
ACGAATGAGAGGGCTTGAGGATCTTGGAGTTGGTACAATAGGATCAAACGGAGAGGCTAATAAGCAGGAAAATGGATTGG
TTAGTGATGAAGAAGACATCAGTGATTCTATGCCGAATGGGGTTCTTGCAAATGGTACTAGCAGGGGTAGCTCTCCGGCG
ATGAAAGGTAAAAGGTCACCAGCTGTAACTGCTATGGCTTCTGTTGCTGTCTCTGAAAACAAAGATTCTGCTGTAGTCAA
CAATGATAACTTGGACAGCAATGGGGTTTCATGTGAGAATGATGATGTTTCATTAAATGCTTCTGAGAATGTTGCTGAAG
TGATGATACATAACAATGCAAAAGAGACTGAAATCTCCAGCATATCAGTTTCGGCAAAGGATGAAGTATTTGATGTTCCG
CTACTTGGAGAAGATAAATACTCTGCAGGAGCTTTCACATCTTCACACACGAAAGCTCTAGCTCTTGTTTCTGAACCAAC
GAGGCAATGTGATGATGTGGTGAAAACGGAAGGATGTAATGGATTTGTTTGTGTAAGTCCATCTGCTTTACTTATCAATG
GGATTGAGGATATCACTTCCAAGTGGCAGATAAAAGGGAAAAGGAACCCAAGGCAGATGAGTAAAAAACAAGAGGAAAGA
AGACTTGCTTACGCCGAAGAAGCCAGCAACAATTCTCTGCCTCACTGTTCTCTCTCTGATCAATATCCACATGGTCATTT
CAGCGGTATGGGAAGAAACTCTCAACTGTATGACGTGAAGATCGAGGGAAAAGGCAGCTACAAACCCAGAAACGTCCCGA
TGATTTCCCTTATGAGTAAACTGGACGGTGAAGCTATCGTCGGTCATCCTCTAACCGTTGAAGTGCTTCAAGATGGATCG
TGTGACCGCATTTTGTGCAGTCATATCAAGTCGCTTGTTGTTCCAATGGTTGCTGGTGATGTGAAGCCGAAGCCATCTTG
GAAGAATAAATCCAAGAAAAAGAAACCACACATTCCTCCGCACAAATCATCAAAGTCAAAGAAAGCTTCGTCCCTATCCG
TAAAGACAAGGTGCCTCTCTGCTCTAAGTGGCCAGAAGCTGACAGTAAGTAGCAAGAAGAAAGTGATGATAGAGAAGACG
AGAGAGGGGATTGTGTCTTGCATCCCTCTGAAAGTAGTCTTCAGTAGGATAAACGAAGCAGTGAAGGGGTCAGCGAGACA
AGTACATAGAGCATTGCCATCTTCAGGCAATAATACTACCTGA