Details for Chinese cabbage Locus Brara.E02075

Position : A05 ( 5`- 19010533 .. 19012071 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02075

Protein [Map View]
MEGLESVYAQAMYGTNRTMEHQGSDLIWGGNELIPRELCSSSSSSHQLINPNLGSCFMSDLGVIAEIQHQQHVGNRAASI
DPSSLECLLSATTNTSTEDDEGISALFSDCQTLWSFGGGISSAESENREITTETTTKPKSLKRNRDETGSHFRLVHHPQD
DSDKGSFKLIYDENQSKSKKPRTEKGGGSSNISFGHSASLSDNAEPDAEAIAQMKEMIYRAAAFRPVNFGLETVEKPKRK
NVKISTDPQTVAARQRRERISEKIRVLQTLVPGGTKMDTASMLDEAANYLKFLRAQVKALENLRPKLDPTNLSFSSPLFH
PSFLPMQNPNQI*

DNA
ATGGAAGGTTTAGAATCGGTTTATGCGCAAGCTATGTACGGCACGAACCGAACCATGGAGCATCAAGGATCAGATTTGAT
CTGGGGAGGCAATGAGCTGATCCCTCGAGAGCTCTGTTCTTCTTCTTCTTCCTCTCACCAGCTCATTAATCCGAATCTTG
GCAGCTGTTTCATGTCCGATCTTGGAGTCATTGCTGAGATTCAACATCAACAACATGTCGGAAACAGAGCTGCTTCCATA
GATCCATCATCGCTGGAGTGTTTGTTATCAGCGACGACGAACACTTCGACGGAAGACGACGAAGGAATCTCTGCGCTTTT
CTCAGATTGTCAGACTCTTTGGAGCTTTGGTGGAGGAATCTCATCTGCAGAATCTGAGAACAGAGAGATCACTACAGAGA
CAACAACAAAGCCTAAGTCTTTGAAGAGAAACAGAGACGAGACAGGAAGTCACTTCCGTCTTGTCCATCATCCTCAAGAT
GATTCCGACAAGGGAAGCTTCAAGCTCATTTACGATGAGAATCAATCAAAATCCAAGAAACCAAGAACAGAGAAAGGAGG
TGGTTCTTCCAACATCAGTTTCGGACATTCAGCTTCTTTGTCTGATAATGCCGAGCCAGATGCAGAAGCGATCGCGCAGA
TGAAGGAGATGATATACAGAGCGGCTGCGTTCAGACCGGTGAACTTCGGTTTGGAGACCGTGGAGAAGCCTAAGAGGAAG
AACGTGAAGATATCGACGGATCCTCAAACGGTGGCGGCGAGGCAGAGGAGGGAGAGGATAAGCGAGAAGATTAGGGTTTT
ACAGACATTGGTTCCAGGTGGGACTAAGATGGACACTGCTTCAATGCTTGATGAGGCTGCTAATTATCTTAAGTTCCTTA
GAGCGCAAGTAAAGGCTTTAGAAAACTTGAGACCCAAGCTTGACCCAACCAATCTCTCCTTCTCCTCTCCTTTATTCCAC
CCTTCTTTTCTTCCCATGCAAAACCCTAACCAGATCTAA