Details for Chinese cabbage Locus Brara.E02072

Position : A05 ( 5`- 18971314 .. 18972807 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02072

Protein [Map View]
MDASLLSADTFNGNAGEQIAPPLQPPGTDMTGICFRDQLWINSYPLDRNYVFDYFALSPFYDITCNNEILRRRSVHPLDH
SQLSKMTGLEYVISDATEPNFFVFRKQKRDGPEKVTPMLTYYILDGSIYQAPQLCTVFAARVGRAVYNISNAFSVAASKL
ETIRQGDAKSQNEPSESKPASETVDLKEVKRVDLILKSLYSKLPPAPPPPPFPEGYVSQEALGEKEEEVGTQGGESQQPQ
IDPIIDQGPAKRMKF*

DNA
ATGGACGCCTCTCTTCTCTCCGCCGATACCTTCAACGGCAATGCGGGGGAGCAGATTGCTCCTCCGCTGCAACCACCAGG
CACGGATATGACCGGTATTTGCTTCAGAGATCAGCTCTGGATCAACTCCTACCCTCTAGACCGTAACTACGTCTTCGACT
ACTTCGCCCTCTCTCCCTTCTACGATATCACCTGCAACAACGAGATCCTTCGTCGTAGATCCGTTCACCCTCTCGACCAC
TCTCAGCTCTCGAAGATGACAGGGTTAGAGTATGTGATCAGCGATGCCACTGAGCCAAACTTTTTCGTGTTTCGGAAGCA
GAAGAGAGATGGTCCTGAGAAAGTCACACCGATGCTGACGTATTATATCTTGGACGGTTCTATATACCAAGCTCCTCAGC
TTTGTACTGTCTTTGCAGCTCGTGTTGGTCGGGCTGTTTATAATATATCTAACGCTTTCTCGGTTGCTGCATCGAAATTG
GAGACCATTAGGCAGGGTGATGCTAAAAGCCAGAACGAACCTTCTGAGTCAAAGCCTGCTAGTGAGACGGTTGATCTTAA
GGAAGTGAAGCGAGTCGATTTGATTCTTAAGTCTTTATATAGCAAGCTACCCCCAGCACCTCCACCACCACCCTTCCCTG
AAGGCTATGTTAGCCAGGAAGCATTAGGGGAAAAGGAAGAAGAGGTTGGAACACAGGGAGGAGAGTCACAACAGCCTCAA
ATTGATCCTATCATCGATCAAGGTCCTGCTAAACGAATGAAGTTCTAA