Details for Chinese cabbage Locus Brara.E02071

Position : A05 ( 5`- 18970455 .. 18971067 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02071

Protein [Map View]
METKPSKSSVFIYVLVLALVLSPILPCQAASVHLGGGGRKLMAPSPPLLMCPHCECCAPAAPGFCCPCSCPGGP*

DNA
ATGGAAACCAAGCCATCGAAGTCCAGCGTCTTCATATATGTTCTAGTTCTTGCACTGGTCTTGTCTCCAATACTCCCATG
TCAAGCAGCTAGTGTGCATCTAGGAGGTGGAGGGCGTAAGTTGATGGCACCATCACCACCACTTCTCATGTGTCCACACT
GTGAGTGTTGCGCACCGGCTGCACCTGGCTTCTGCTGCCCATGTAGCTGTCCCGGTGGTCCCTAA