Details for Chinese cabbage Locus Brara.E02070

Position : A05 ( 5`- 18955554 .. 18956977 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02070

Protein [Map View]
MAEPFVETRIPQQKLYESKPFPAVISPSLPAPSLPLFTQTITTHKPYLDSLLHRSGAVLFRGFPVNSATDFNDVVEAFGF
DELPYVGGAAPRTSVVGRVFTANESPPDQKIPFHHEMAQVPEFPSKLFFYCEVEPNSGGETPIVLSHVVYERMKEKHPEF
VQRLEEHGLVYVRVLGEDDDPSSPIGRGWKSTFLTHDKNVAEERAAKLGMKLEWTEEGGAKTIMGPIPAIKFDKSRNRKV
WFNSMVAAYTGWEDKRNDPRKAVTFGNGEPLPEDIVHDCLRILEEECVAVPWQRGDVLLIDNWAVLHSRRPFVPPRRVLA
SLCK*

DNA
ATGGCCGAACCGTTTGTCGAAACTCGAATCCCACAGCAAAAGCTCTACGAATCGAAACCTTTCCCGGCGGTAATCTCGCC
GTCACTCCCCGCTCCGTCTCTCCCACTCTTCACACAAACCATCACCACCCACAAACCCTATCTCGACTCCCTCCTCCACC
GATCCGGAGCCGTCCTCTTCAGAGGCTTCCCCGTGAACTCCGCCACCGACTTCAACGACGTCGTTGAGGCTTTCGGTTTC
GACGAGCTTCCTTACGTAGGAGGCGCCGCGCCACGCACTAGCGTCGTAGGACGTGTCTTCACCGCCAACGAGTCCCCACC
TGATCAAAAGATCCCATTTCACCACGAGATGGCTCAGGTTCCTGAGTTTCCATCAAAGTTGTTCTTTTACTGCGAGGTGG
AGCCTAACTCTGGAGGAGAGACACCTATCGTGTTGAGTCACGTTGTGTACGAGAGAATGAAGGAGAAGCATCCAGAGTTT
GTTCAGAGGTTGGAGGAACATGGTTTGGTCTACGTCAGGGTTTTAGGTGAAGATGATGATCCTTCTTCACCCATCGGCCG
TGGCTGGAAATCAACATTCTTGACTCATGACAAGAACGTTGCTGAGGAAAGGGCGGCTAAGCTGGGAATGAAACTGGAAT
GGACCGAGGAAGGAGGAGCCAAGACTATAATGGGTCCAATCCCAGCGATCAAGTTTGACAAGTCGAGGAATCGTAAAGTG
TGGTTTAACAGCATGGTGGCTGCTTACACAGGGTGGGAGGATAAGAGGAATGATCCAAGGAAGGCTGTGACTTTTGGAAA
CGGGGAGCCTTTACCTGAAGATATAGTCCATGACTGTTTAAGGATACTCGAAGAAGAATGTGTTGCTGTTCCGTGGCAGA
GAGGAGATGTTCTGCTTATAGACAACTGGGCTGTTCTTCACTCACGTAGACCGTTTGTTCCTCCTCGCAGAGTGCTTGCA
TCGCTCTGCAAATAG