Details for Chinese cabbage Locus Brara.E02069

Position : A05 ( 5`- 18954181 .. 18955554 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02069

Protein [Map View]
MGQQLRRAVGRVKEVEKFPSRLDRRSLPKEELSAGKSPSINDVSARGSSSDDSERDPQYDTMLNQMVGRIKAKPGGKAEM
GEASVVETSKRPLPKLRNTTPESTRYEAKPVPQGTLNVAQVRHIMLLYQGKAQDHKGPMTLNEIAKNYRIDVSQVQKITQ
FLSLPPEATDKQKKRYE*

DNA
ATGGGTCAGCAACTGCGTCGAGCCGTTGGGAGAGTCAAAGAAGTTGAAAAGTTTCCATCAAGGCTCGATCGGAGATCTCT
TCCAAAAGAAGAACTCAGCGCCGGGAAATCTCCGTCTATCAATGATGTTTCTGCTCGAGGAAGCAGCAGTGATGATAGTG
AAAGAGACCCACAATACGATACAATGTTGAACCAAATGGTTGGGAGAATAAAGGCTAAACCCGGTGGTAAAGCTGAGATG
GGCGAGGCATCGGTAGTGGAAACGTCGAAAAGGCCACTCCCAAAGCTCCGGAACACTACTCCTGAATCAACAAGGTACGA
GGCAAAACCGGTGCCGCAAGGAACACTAAACGTGGCTCAAGTGAGACACATCATGCTTCTCTATCAGGGCAAGGCTCAGG
ATCACAAGGGTCCAATGACTCTGAACGAAATTGCCAAAAACTACAGGATTGACGTCTCCCAGGTCCAGAAAATCACCCAG
TTCCTGTCCTTGCCACCAGAGGCTACTGATAAGCAGAAGAAACGATATGAATAA