Details for Chinese cabbage Locus Brara.E02063

Position : A05 ( 5`- 18904021 .. 18908351 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02063

Protein [Map View]
MTKDHNFSENQDTQPIDSPPSSPSDSGEEKDGFFGNLGDEFMNDTVPFEDDAWINDEFMATQVIDNDEFLLCRETQAVDL
GFGTQEEPFVEDEQLLQGFDGLATQVLDPSDEDSDDVDVTVFLVDNSEVSDCGDSSSRRKLLSSEDKSREHAPSSGHENV
KPTGKVARFASVRSAAFRASAVSAQKLLNRDTPTLASCHSTGQGATNSSILQQHFGEVGNQKFPPNTFVEKKNDGKRTAR
KLLFEDDSPEENCPSPGLSYIDSQEPGEASQASALKFVDKLISESGLNLDVEAEDDYGRRREETLHKISSVKGPQELAKK
ASLKARAHGKSMFDWDDNREDEGGGDICLRRKEELFGVASKAQKPSSLPREQRRELGVSVDKSQRKSRSDSRLLQCTVTR
GPKMIQAAKKNLGKELDAVAEEGYNNTSDIRDLVELGYETQVAAEAVDAVRSGGGSKVNAEASPGNKLSPGEERVITRQS
KGTKRIQAMGKEELLRRRMNKASPSPAKACRKSIERSLQSDQLYKEGPNCSKRRIVHTAPRESRDNLVDEMDEVSKESKT
RMFDRREEVEAGPDTQMAAEVISALHSGDARDEAKKSSRGVVTRKSKRLKGIQAVDDDDESLKPKTKKAKSVLVKAYSKN
EKVDLPDEVVVSKLLKQPSGGEADVLSYPKRRRSARFLQDQVTEAERSSEPAFDTPAKSKAPSKNVSPICMGDEYHKLSC
KDSRTSNTTREFRNLTSPSMEPVPETKSTRKRRDLRSVRVLFSQHLDEDVTKHQKKILARFDISEASSMTEATHFIADNF
TRTRNMLEAIASGKPVVTTQWLESIDQVNIYVDEDLYLLRDSKKEKEFGFNMGVSLARARQNPLLKGRRVFITPNTKPGL
NTITTLVKAVHGQPVERVGRSVLNDDKVPENLLVLSCEEDRDISIPFLERGAEVYSSELVLNGIVTQKLEYERYRLFTDH
VRRTRSTIWIRDGKGKFQRRRG*

DNA
ATGACTAAAGATCACAACTTTTCGGAGAATCAAGACACCCAGCCGATTGATTCTCCTCCCTCTTCGCCTTCCGACTCTGG
TGAAGAGAAAGATGGTTTCTTTGGGAATCTTGGCGATGAGTTTATGAACGACACTGTACCTTTTGAGGACGATGCTTGGA
TCAATGATGAGTTTATGGCGACTCAGGTCATAGACAACGACGAGTTTCTTCTCTGTCGCGAAACTCAAGCTGTGGATTTG
GGGTTTGGAACTCAAGAAGAACCATTTGTAGAGGATGAGCAGTTACTCCAAGGTTTTGATGGCTTGGCTACGCAGGTGCT
GGATCCTTCTGATGAGGATAGTGATGATGTTGATGTTACTGTTTTCTTGGTGGACAACAGCGAGGTCTCTGATTGTGGTG
ACTCGAGTAGTAGAAGAAAGCTGTTATCAAGTGAAGATAAGAGTAGAGAGCATGCTCCGTCGAGTGGACATGAAAACGTT
AAGCCAACGGGAAAGGTGGCCAGGTTTGCTTCAGTTCGTTCAGCAGCTTTTCGTGCTTCTGCTGTTTCAGCCCAGAAGCT
TCTCAACAGAGACACTCCTACTTTAGCCAGCTGCCATTCTACTGGTCAAGGAGCCACAAATAGTTCCATTCTACAACAAC
ATTTTGGAGAAGTAGGGAATCAGAAGTTTCCTCCCAATACGTTTGTTGAAAAGAAAAATGACGGAAAAAGAACAGCGAGG
AAGCTTTTATTTGAGGACGATTCGCCTGAAGAAAACTGCCCTTCTCCTGGTTTGAGTTATATAGACTCGCAAGAGCCTGG
TGAGGCATCACAGGCCAGTGCTCTTAAATTCGTTGATAAACTCATTAGTGAGTCAGGTCTAAACCTTGATGTTGAAGCTG
AAGATGATTACGGAAGGAGAAGAGAAGAAACATTACACAAAATCTCGAGTGTTAAAGGTCCACAAGAATTAGCAAAGAAA
GCAAGTCTCAAAGCGAGAGCTCATGGAAAGAGTATGTTTGACTGGGATGATAATCGTGAGGATGAAGGAGGAGGTGATAT
TTGTCTTAGAAGAAAGGAAGAACTTTTTGGGGTTGCAAGTAAAGCACAGAAACCTTCTTCCTTGCCTAGAGAACAGAGAA
GGGAACTTGGAGTTTCAGTGGATAAAAGTCAAAGAAAGTCTCGTTCTGATTCAAGACTGTTGCAGTGTACTGTGACTAGG
GGTCCAAAGATGATTCAAGCCGCTAAAAAGAATCTTGGCAAAGAGTTAGATGCCGTTGCCGAGGAAGGTTATAATAATAC
ATCTGATATACGTGACTTGGTAGAGTTAGGGTATGAGACACAAGTGGCTGCTGAAGCTGTTGATGCTGTGCGCTCTGGAG
GTGGCAGCAAAGTTAATGCTGAAGCTAGTCCAGGAAATAAACTGTCACCGGGAGAAGAGAGAGTGATTACTAGACAATCC
AAGGGAACGAAGAGGATTCAAGCTATGGGTAAAGAGGAATTGTTGAGAAGAAGGATGAATAAGGCTAGTCCGAGTCCTGC
TAAAGCTTGCAGAAAGAGTATTGAAAGGTCTTTACAGAGTGACCAGCTTTACAAGGAAGGTCCAAACTGCTCGAAGAGAA
GGATTGTCCATACTGCTCCACGAGAGAGTAGAGATAATCTTGTTGATGAGATGGATGAAGTTTCCAAGGAAAGTAAAACA
AGAATGTTTGATAGGCGAGAAGAGGTAGAAGCAGGCCCTGATACGCAGATGGCTGCTGAAGTTATCAGTGCTCTGCACTC
TGGGGACGCCAGGGATGAGGCTAAGAAATCTTCACGTGGAGTTGTTACTAGGAAGTCCAAGAGACTTAAGGGGATTCAAG
CTGTAGATGATGATGATGAATCGTTGAAACCAAAAACCAAGAAGGCTAAATCAGTTCTTGTCAAGGCTTATTCAAAGAAT
GAGAAAGTTGATTTGCCAGATGAAGTTGTTGTGTCTAAGCTACTTAAGCAACCAAGTGGAGGTGAAGCAGATGTGTTGAG
TTATCCCAAGCGGAGAAGGTCAGCTCGTTTCTTGCAAGACCAGGTTACTGAGGCAGAGAGGAGTTCAGAACCTGCTTTTG
ATACTCCAGCTAAATCTAAGGCCCCTTCAAAGAATGTATCACCTATATGCATGGGAGATGAGTATCATAAACTTTCTTGC
AAGGATTCACGTACATCAAACACTACAAGGGAGTTCCGTAACTTGACCTCACCATCGATGGAGCCTGTTCCCGAGACAAA
GAGTACAAGAAAGCGAAGAGACTTGCGTAGTGTACGTGTCTTGTTCAGCCAGCATCTTGATGAAGATGTGACCAAGCACC
AGAAGAAGATTTTGGCTAGGTTTGATATCTCGGAAGCATCTTCCATGACAGAGGCAACACATTTTATAGCGGATAACTTT
ACGCGCACAAGGAACATGCTTGAGGCAATCGCTTCAGGGAAGCCAGTGGTGACAACACAGTGGCTTGAAAGCATTGATCA
GGTGAATATTTATGTTGACGAGGATCTTTACTTACTCAGAGACTCAAAGAAGGAGAAGGAGTTCGGTTTCAACATGGGGG
TTTCTTTGGCTCGTGCACGACAGAATCCGCTACTAAAGGGGAGAAGAGTCTTTATCACTCCAAATACAAAGCCTGGTTTG
AACACAATCACAACTTTGGTTAAGGCAGTTCATGGACAGCCTGTAGAAAGAGTGGGAAGATCTGTCCTAAACGACGATAA
GGTCCCAGAGAATCTTCTAGTTTTATCATGTGAAGAGGATCGAGATATCAGCATACCATTTCTAGAAAGAGGGGCTGAGG
TGTATAGCTCTGAGTTAGTGCTTAATGGGATAGTTACTCAAAAACTAGAGTACGAGAGGTACCGTCTCTTCACTGATCAT
GTTAGGAGAACAAGGTCAACGATATGGATCAGAGACGGCAAAGGAAAGTTCCAACGCCGTAGAGGGTGA