Details for Chinese cabbage Locus Brara.E02056

Position : A05 ( 5`- 18833633 .. 18835392 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02056

Protein [Map View]
MDEVMTVADAGGSRALNGSPSSQNLLPHNLPLLSAFLAFALAQFLKVFTNWYKEKRWDSKKMISSGGMPSSHSATVTALA
LAIALAEGAGSPAFAIALVLACVVMYDASGVRLHAGRQAELLNQIVCEFPSEHPLSTVKPLRELLGHTPIQVAAGAVLGC
VVAYLTRSTS*

DNA
ATGGACGAGGTGATGACAGTGGCGGACGCCGGCGGAAGCAGGGCGTTGAACGGATCTCCTTCGTCGCAGAATCTCCTTCC
CCACAATCTTCCCCTCTTATCCGCTTTTCTTGCATTCGCCCTCGCTCAGTTCCTCAAAGTCTTCACTAATTGGTACAAAG
AAAAGAGATGGGACTCTAAAAAGATGATCAGTTCTGGTGGAATGCCTTCCTCTCACTCTGCTACCGTCACTGCCTTAGCT
CTTGCCATTGCCCTTGCAGAAGGTGCTGGATCACCCGCTTTTGCTATCGCTCTTGTCTTGGCCTGCGTTGTAATGTATGA
TGCCTCTGGGGTCAGGCTTCATGCTGGTCGTCAAGCTGAGCTACTGAATCAAATTGTTTGTGAGTTTCCGTCCGAGCATC
CGTTATCCACAGTTAAACCCTTGCGTGAACTGCTCGGCCACACTCCTATCCAGGTTGCAGCCGGTGCTGTTTTAGGATGC
GTGGTAGCTTATTTGACGAGGAGCACAAGCTAG