Details for Chinese cabbage Locus Brara.E02055

Position : A05 ( 5`- 18829464 .. 18832657 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02055

Protein [Map View]
MELRIQIATLLLLLFWPSSLFFTVESKCSGSCNLALASYFLENGTTLSNINQNLNSPEAPYDQINFEPILRYNPSITNKD
LIQMGTRLLVPFPCECQPGDFLAHVFTYSVQPEDTYDIVATEHYANLTTEDSLRRTNTFPATNIPPSATLNVSVNCFCGN
ESVSKDYGLFVTYPLRPEDSLDAIASSSGVPAETLQRYNPGVDFRSGSGIVFVPGKDPNGTFPPFKSSDKGGLGAGVIAG
ICVGVLVALLLISFVIYYVYRKNKKQESHSSSIPLSAKVDQASLQSGDLVGTGVAPGLAAISVDKSVEFTLEELAKATDN
FNLSFKIGQGGFGAVYYAELRGEKAAIKKMDMEASKQFLAELKVLTRVHHVNLVRLIGYCVEGSLFLIYEYVENGNLGQH
LHGSGREPLPWTKRVHIALDSARGLEYIHEHTVPVYVHRDIKSANILIDQNFRAKVADFGLTKLTEVGSSATRGAMGTFG
YMAPEIVYGEVSAKVDVYAFGVVLYELISAKAAVVKMNQASGEFRGLVGVFEEVFKEADKEEALRKIIDPRLGDNYPFDS
VYKMAELGKACTQENAQLRPSMRYIVVALSTLFSSTGNWDVGNFQNDDIVSLMSGR*

DNA
ATGGAGCTACGGATCCAAATTGCTACTCTTCTCCTTCTCCTCTTCTGGCCGTCGTCTCTGTTCTTCACCGTGGAATCTAA
ATGCAGTGGAAGCTGCAACTTAGCTTTAGCCTCTTACTTCCTTGAAAACGGAACAACCCTCTCCAACATCAACCAGAACC
TCAACTCTCCCGAGGCTCCTTACGATCAAATCAACTTCGAGCCGATCCTAAGGTACAACCCCAGCATAACAAACAAAGAC
TTAATCCAGATGGGTACTCGCCTTCTTGTCCCTTTCCCTTGCGAGTGCCAACCGGGAGACTTCCTCGCCCACGTGTTCAC
ATACAGTGTCCAACCGGAAGATACTTATGACATAGTTGCGACTGAACATTACGCGAACCTCACGACGGAGGACTCTTTGC
GGAGAACCAACACTTTCCCGGCGACTAACATCCCTCCCTCCGCGACGCTTAACGTGTCCGTGAACTGCTTTTGCGGTAAC
GAGAGTGTGTCTAAGGATTATGGGTTGTTCGTTACTTACCCGCTTCGTCCTGAAGACAGTCTCGACGCGATCGCGAGTTC
TTCCGGCGTACCGGCGGAGACTCTGCAGAGGTATAACCCTGGTGTTGATTTCCGGTCAGGGAGTGGCATTGTCTTTGTTC
CGGGGAAAGATCCAAATGGTACATTCCCACCTTTCAAATCAAGTGACAAAGGTGGGCTTGGTGCTGGAGTTATAGCTGGT
ATATGTGTAGGAGTGTTGGTGGCTCTGTTGTTGATCTCCTTTGTCATATACTATGTTTACCGAAAGAACAAGAAACAAGA
GTCACATTCATCTTCTATTCCGTTGTCTGCTAAGGTTGATCAGGCTAGCCTCCAGAGTGGCGACTTGGTTGGTACAGGAG
TTGCTCCTGGCCTTGCCGCCATAAGCGTGGACAAGTCTGTTGAGTTTACCTTGGAGGAGCTCGCAAAGGCTACTGATAAT
TTCAATCTGTCTTTTAAGATAGGGCAAGGTGGTTTTGGTGCTGTTTACTATGCAGAGCTTAGAGGAGAAAAAGCTGCAAT
CAAGAAGATGGACATGGAGGCATCGAAACAGTTCTTGGCAGAACTAAAAGTCTTGACACGTGTACATCATGTCAACCTGG
TTCGTCTGATTGGTTATTGTGTAGAGGGATCTCTTTTCTTGATCTATGAGTATGTTGAGAATGGCAACCTTGGACAACAT
TTACATGGATCAGGACGTGAACCGCTACCGTGGACTAAGAGAGTCCACATTGCGCTAGATTCAGCTAGAGGTTTAGAGTA
TATCCACGAGCACACGGTTCCAGTTTATGTTCACAGGGACATTAAATCTGCCAATATATTGATAGATCAGAACTTCAGAG
CAAAGGTCGCTGATTTCGGTTTAACAAAACTGACAGAGGTGGGAAGCTCGGCGACACGTGGTGCGATGGGTACATTTGGT
TACATGGCACCTGAGATTGTATATGGAGAAGTGTCTGCGAAAGTAGATGTATATGCATTTGGAGTTGTCCTCTACGAGTT
GATCTCTGCGAAAGCCGCGGTTGTCAAGATGAACCAAGCCAGTGGTGAATTCAGAGGCCTCGTTGGTGTGTTCGAAGAAG
TGTTCAAGGAGGCAGACAAAGAAGAAGCACTACGGAAGATTATCGACCCCAGGCTTGGTGATAACTATCCGTTTGATTCT
GTATATAAGATGGCGGAGCTAGGGAAAGCTTGTACGCAAGAGAACGCGCAGCTACGTCCAAGTATGAGATACATTGTGGT
TGCTTTATCTACTCTGTTCTCTTCAACCGGAAACTGGGACGTCGGAAACTTCCAGAACGATGATATTGTCAGCCTTATGT
CTGGCCGGTAG