Details for Chinese cabbage Locus Brara.E02053

Position : A05 ( 5`- 18819945 .. 18822452 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02053

Protein [Map View]
MVHVSSHGAKDGSEEAFDYRGNPPDKSKTGGWLGAGLILGSELSERICVMGISMNLVTYLVGDLHISSAKSATIVTNFMG
TLNLLGLLGGFLADAKLGRYKMVAISASVTALGVLLLTVATTIPSMRPPLCDDFRRLHHQCVEANGHQLALLYVALYTIA
LGGGGIKSNVSGFGSDQFDTSDPKEEKQMIFFFNRFYFSISLGSLFAVIVLVYVQDNVGRGWGYGISAATMVVAAVVLLC
GTKLYRFKKPKGSPFTVIWRVCFLAWKKRNESYPSHQSLLNGYETTTVPHTERLKCLDKAAVVVEESSPSTKEFKEKDPW
MVSTVTQVEEVKLVVKLIPIWATNILFWTIYSQMTTFTVEQATFMERKLGSFTVPAGSYSAFLILTILLFTSLNERVFVP
LARMVTKKPQGITSLQRIGVGLVLSMAAMAVAAVIENARREAEVTSGYKISAFWLIPQYFLVGAGEAFAYVGQLEFFIRE
APERMKSMSTGLFLSTISMGFFVSSLLVSLVDKVTHKSWLRSNLNKARLNYFYWLLVVLGAFNFLVFIVFAMKHQYKADM
ISVGVDDSVEKEKEKSELELKDIP*

DNA
ATGGTTCATGTGTCGTCGCATGGAGCAAAAGATGGCTCGGAAGAAGCCTTTGACTATAGAGGAAATCCACCTGATAAGTC
CAAAACCGGTGGATGGTTAGGCGCCGGTTTAATCTTAGGGAGTGAACTTTCGGAGAGAATATGCGTGATGGGCATATCAA
TGAACCTAGTGACGTACCTTGTCGGAGATTTACACATCTCATCAGCAAAATCTGCAACCATAGTGACAAACTTCATGGGA
ACTCTCAACCTCTTAGGACTTCTTGGTGGTTTCTTGGCTGATGCTAAACTCGGTCGGTACAAGATGGTCGCAATCTCAGC
CTCTGTCACAGCTCTGGGAGTGTTGCTGTTGACAGTGGCAACAACCATCCCAAGCATGAGACCACCACTCTGTGATGACT
TCAGGAGACTTCACCATCAGTGCGTAGAAGCAAACGGTCACCAGCTAGCTCTTCTCTACGTCGCTCTCTACACCATAGCT
CTAGGCGGAGGAGGGATCAAGTCCAACGTGTCCGGTTTCGGGTCTGACCAGTTCGACACGAGTGATCCCAAAGAAGAGAA
GCAGATGATTTTCTTCTTCAACAGATTCTACTTCTCCATCAGCCTCGGGTCTCTCTTCGCCGTGATTGTCCTGGTTTACG
TCCAGGACAACGTCGGGAGAGGCTGGGGCTACGGAATCTCGGCCGCGACCATGGTTGTCGCGGCCGTGGTTCTGCTCTGC
GGGACGAAGCTGTACCGTTTCAAGAAACCTAAGGGAAGTCCTTTCACTGTTATATGGAGGGTTTGTTTCTTGGCGTGGAA
GAAAAGAAACGAAAGCTACCCTTCGCATCAGAGTCTTTTAAACGGTTATGAAACCACAACGGTTCCTCACACCGAGAGGC
TAAAGTGTTTAGACAAAGCCGCGGTTGTCGTAGAAGAGAGCTCTCCTAGTACCAAGGAGTTCAAAGAGAAGGATCCGTGG
ATGGTTTCGACCGTTACGCAGGTCGAAGAAGTGAAGCTAGTTGTGAAACTGATTCCCATTTGGGCAACGAACATTCTCTT
CTGGACGATTTACTCTCAAATGACGACTTTCACGGTGGAACAAGCCACGTTCATGGAGCGTAAACTCGGGTCTTTCACGG
TTCCCGCAGGCTCCTACTCTGCGTTTCTCATCCTCACCATTCTCCTCTTCACTTCCCTTAACGAGAGAGTCTTTGTGCCT
TTAGCAAGAATGGTCACAAAGAAGCCTCAAGGAATCACCAGCCTTCAGAGAATAGGAGTAGGGCTTGTGTTGTCAATGGC
TGCAATGGCGGTAGCCGCGGTTATAGAGAACGCTAGACGCGAGGCAGAGGTTACCAGCGGTTATAAGATAAGCGCGTTCT
GGTTGATTCCACAGTACTTCTTGGTTGGTGCGGGTGAAGCTTTTGCTTACGTTGGGCAGCTTGAGTTTTTTATAAGAGAA
GCACCAGAGAGGATGAAGTCGATGAGCACCGGTTTGTTTTTGAGCACGATTTCGATGGGATTCTTTGTGAGCAGCTTGCT
TGTTTCTCTTGTTGATAAGGTAACGCACAAGAGCTGGCTTAGAAGCAACCTTAACAAAGCGAGATTGAACTACTTCTACT
GGTTGCTTGTTGTCTTGGGAGCTTTTAATTTCTTGGTTTTTATAGTGTTTGCGATGAAGCATCAGTATAAAGCTGATATG
ATTAGTGTTGGGGTTGATGATTCAGTGGAGAAGGAGAAAGAAAAATCTGAGTTGGAGCTTAAAGACATTCCATAA