Details for Chinese cabbage Locus Brara.E02050

Position : A05 ( 5`- 18766632 .. 18771026 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02050

Protein [Map View]
MDSSQYDGVYQPLLYPPADGTVPLSPSTESSNGELERVLSDVETPLFHRIRKATMIESKLLFKLAAPAVIVYMINYLMSM
STQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGGRKYEMLGIYLQRSTVLLTLTGLLLTLIYIFS
KPILLFLGESPEIASAASIFVYGLIPQIFAYAVNFPIQKFLQAQSIVAPSAFISTATLFVHLFLSWLAVYKLGMGLLGAS
LVLSLSWWIIVVAQFVYIVTSERCCQTWRGFSVQAFSGLPSFFKLSAASAVMLCLETWYFQILVLLAGLLENPELALDSL
SICMTISGWVFMISVGFNAAISVRVSNELGAGNPKSAAFSVIIVNIYSLITSVILAIVILACRDFLSYAFTEGKKVSVAV
SDLCPLLALTLVLNGIQPVLSGVAVGCGWQAFVAKVNVGCYYIIGIPLGVIFGFYFKFDAKAI*

DNA
ATGGACTCGTCTCAATACGATGGCGTATACCAACCGCTTCTCTACCCTCCGGCTGATGGAACTGTACCGCTTTCTCCATC
GACGGAGTCAAGCAACGGCGAGCTAGAGAGAGTGCTTTCCGACGTTGAAACTCCGTTATTTCACCGCATTCGTAAGGCCA
CGATGATTGAATCCAAGCTGCTCTTCAAGCTTGCTGCACCTGCGGTCATCGTCTACATGATAAACTACCTCATGTCCATG
TCCACTCAAATCTTCTCTGGCCATCTAGGCAACCTAGAACTCGCCGCCGCTTCTCTTGGTAACACTGGAATCCAAATCTT
CGCCTACGGTCTCATGCTAGGGATGGGTAGTGCGGTAGAGACGTTGTGTGGTCAAGCGTTTGGAGGTAGAAAATACGAGA
TGCTTGGCATTTATCTCCAGAGATCCACCGTTTTGCTTACTCTCACGGGCCTTCTCCTAACGTTAATCTACATCTTCTCC
AAACCTATTTTGCTTTTCCTCGGAGAGTCGCCGGAGATAGCTTCCGCCGCGTCAATCTTTGTATACGGCCTAATTCCTCA
AATCTTTGCCTACGCCGTAAACTTCCCGATCCAAAAGTTCCTCCAGGCGCAAAGCATCGTGGCACCGAGTGCTTTCATCT
CTACGGCCACTCTCTTTGTTCACCTTTTCTTAAGCTGGCTCGCTGTTTACAAGCTTGGCATGGGGCTTCTTGGAGCGTCG
CTCGTGCTCAGTCTCTCGTGGTGGATTATAGTGGTGGCTCAGTTTGTTTACATCGTGACGAGTGAACGGTGTTGTCAGAC
GTGGAGAGGGTTTAGTGTGCAAGCATTTTCTGGGTTACCGAGTTTTTTCAAACTCTCCGCCGCCTCCGCCGTGATGCTTT
GCCTTGAGACTTGGTATTTTCAGATCTTGGTTCTTCTTGCCGGACTCCTCGAGAATCCGGAGCTTGCTCTAGATTCTCTC
TCCATTTGCATGACGATTTCAGGATGGGTGTTTATGATATCTGTTGGGTTCAATGCAGCGATAAGTGTAAGAGTGAGTAA
TGAACTTGGAGCTGGAAACCCTAAATCAGCAGCGTTTTCTGTAATCATCGTCAACATATATTCCTTAATCACAAGTGTGA
TCTTAGCCATTGTTATTTTGGCATGCCGTGACTTCTTGAGTTATGCGTTCACTGAGGGTAAAAAGGTTTCGGTCGCGGTT
TCTGACCTTTGCCCGCTACTTGCCTTGACGCTTGTTCTCAATGGAATCCAACCCGTTCTTTCTGGTGTGGCGGTTGGATG
CGGTTGGCAAGCGTTTGTGGCGAAAGTTAACGTTGGATGTTATTACATTATCGGAATTCCTCTTGGGGTTATCTTTGGGT
TTTACTTCAAGTTCGATGCCAAGGCAATATAG