Details for Chinese cabbage Locus Brara.E02044

Position : A05 ( 5`- 18715942 .. 18717550 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02044

Protein [Map View]
MSHWRHKVWRHLSSFHGASYSTRPSRINKTMLNDLRRIRPMIQRRIENRAKDYPIQEIVPVAKDILKARQNLLTNVTVLL
KAFPVLRCKFCSEVFVGKEGHLIQTCRSYIRRGNNRLHEWVPGSINDVLVPVESFHLHNMSQGVIRHQQRFDYDRVPAIL
ELCCQAGAIHPEEILEYAKVHDNPQISDEDIRSIPTEDLKYVGANALTAWEKVRAGLKKLLLVYPSKVCKRCKEVHVGPS
GHKARLCGVFKYESYQGTHYWEKAGVNDLVPEKVVWHRRPQDPLVLVNEGRNYYGHAPAVVSLCSHAGALVSNTRYACEM
KPQGLSYPLSN*

DNA
ATGTCGCATTGGAGACACAAAGTGTGGCGACATTTGAGCTCATTTCATGGAGCTAGCTACTCAACAAGGCCTTCAAGAAT
CAACAAAACAATGCTCAACGACCTTAGAAGAATCAGACCAATGATCCAAAGAAGAATCGAGAATCGAGCAAAAGATTACC
CGATTCAAGAGATTGTTCCTGTGGCTAAAGACATCCTCAAAGCCAGACAAAACCTACTCACTAACGTCACTGTTCTTCTT
AAAGCGTTTCCTGTCTTGAGATGCAAGTTCTGCTCAGAAGTGTTTGTTGGCAAAGAAGGGCATTTGATTCAAACGTGCCG
TAGTTATATACGGCGCGGCAACAACAGGCTACATGAATGGGTTCCAGGCTCTATAAACGATGTACTTGTCCCCGTTGAGT
CCTTCCACTTGCACAACATGTCTCAAGGTGTTATCAGACACCAACAGAGGTTTGATTATGACCGTGTTCCCGCCATCTTG
GAGCTATGCTGTCAAGCAGGAGCCATCCATCCTGAAGAGATCTTGGAATATGCGAAAGTTCATGATAACCCGCAGATCTC
TGATGAAGATATCAGGAGTATACCCACTGAAGACCTCAAATACGTTGGAGCAAACGCTCTAACGGCGTGGGAGAAAGTTA
GAGCTGGTCTGAAGAAACTGTTGCTTGTTTATCCTTCTAAAGTTTGCAAACGGTGCAAAGAGGTTCACGTGGGACCGAGC
GGTCATAAAGCTCGTCTGTGTGGTGTGTTCAAGTACGAGAGCTATCAGGGGACTCATTATTGGGAAAAGGCTGGTGTGAA
CGATTTGGTTCCTGAGAAAGTCGTGTGGCACCGGAGGCCTCAGGACCCGTTGGTTCTTGTGAACGAAGGGAGGAATTATT
ACGGACATGCCCCTGCCGTAGTGAGCCTTTGTAGCCATGCAGGTGCACTTGTTAGCAACACAAGATATGCTTGCGAGATG
AAGCCGCAAGGTTTATCGTATCCTCTTAGTAATTAA