Details for Chinese cabbage Locus Brara.E02040

Position : A05 ( 5`- 18677783 .. 18681922 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02040

Protein [Map View]
MKLLHVMAAFAAMFLMGMFVSSDAQLQMNFYAKSCPKAEKIISDHIEKHIHNGPSLAAPLIRMHFHDCFVRGCDGSVLIN
STSGNAEKDAPPNLTLRGFGFVERIKTILEAECPKTVSCADIIALTARDAVVATGGPWWSVPTGRRDGRISNLTEASNNI
PPPTSNFTTLQRLFSNQGLNLKDLVLLSGAHTIGVSHCSSMNTRLYNFSTTVKQDPALDSEYAANLKANKCKSLNDNTTI
LEMDPGSRKSFDLSYYRLVLKRRGLFQSDSALTTNSATLKMINDLVNGSEEKFYKAFAKSMEKMGRVKVKTGSAGVIRTV
CSVAGS*

DNA
ATGAAGCTATTACATGTCATGGCTGCCTTTGCAGCGATGTTTCTTATGGGAATGTTTGTATCATCCGATGCTCAGCTTCA
AATGAATTTCTACGCCAAAAGCTGTCCAAAAGCAGAGAAAATAATTTCGGATCATATTGAAAAACATATCCATAATGGTC
CTTCTCTTGCAGCTCCTCTCATCAGAATGCACTTCCATGATTGCTTCGTCAGGGGATGTGATGGATCAGTGTTGATAAAT
TCAACATCTGGGAACGCAGAGAAAGATGCACCACCAAATCTAACACTTAGAGGATTCGGTTTCGTGGAGAGAATAAAGAC
TATTCTCGAGGCAGAGTGTCCTAAGACTGTATCCTGCGCTGATATCATCGCTTTGACCGCTAGAGACGCAGTTGTTGCCA
CCGGAGGTCCTTGGTGGAGTGTTCCGACTGGAAGAAGAGACGGTAGGATCTCAAATTTGACTGAGGCTTCGAACAACATT
CCCCCGCCAACTAGTAACTTCACCACGTTACAACGACTTTTCTCTAACCAAGGCCTTAATCTCAAAGACCTTGTCCTACT
CTCCGGGGCTCACACTATTGGTGTCTCTCATTGTTCTTCCATGAATACTCGCCTCTACAACTTCTCGACGACAGTCAAAC
AAGATCCAGCTCTGGACAGCGAGTACGCAGCGAACCTAAAGGCCAACAAATGTAAGAGCCTCAATGACAATACCACCATT
CTCGAGATGGATCCAGGTAGCCGTAAAAGCTTCGATCTCAGTTACTACAGGCTTGTCTTGAAGAGGAGAGGTCTCTTTCA
GTCTGATTCTGCCTTGACGACAAACTCAGCTACGTTAAAGATGATCAACGACTTGGTCAATGGTTCTGAAGAGAAGTTTT
ACAAGGCTTTCGCTAAGTCGATGGAGAAGATGGGGAGAGTTAAAGTGAAGACGGGCTCAGCCGGTGTGATCAGGACAGTT
TGTTCTGTTGCCGGAAGTTAG